HHsearch alignment for GI: 254780725 and conserved domain: KOG1532

>KOG1532 consensus.
Probab=97.43  E-value=0.0025  Score=39.68  Aligned_cols=181  Identities=16%  Similarity=0.191  Sum_probs=96.2

Q ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHH
Q ss_conf             45675379997469887756899999999996269949999787989860334389987898886318456124337653
Q gi|254780725|r  157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL  236 (427)
Q Consensus       157 ~~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~  236 (427)
T Consensus        15 ~~~~p~~ilVvG-MAGSGKTTF~QrL~~hl~~-~~~ppYviNLDPAv~~vpy~aniDI----RDtV---------kYkEv   79 (366)
T KOG1532          15 AIQRPVIILVVG-MAGSGKTTFMQRLNSHLHA-KKTPPYVINLDPAVRNVPYPANIDI----RDTV---------KYKEV   79 (366)
T ss_pred             CCCCCCEEEEEE-CCCCCCHHHHHHHHHHHHH-CCCCCEEEECCHHHHCCCCCCCCCH----HHHH---------HHHHH
T ss_conf             556870799994-4778841399999999862-3699808867888854888667756----6543---------09999


Q ss_pred             HHCCC--CCEEEEECCCCCCCHHCCCHHHHHHHHHHHHHCCCEEEECCCCCCCH--H------HHHHHHHCC-CC--CCC
Q ss_conf             20248--98068724876120320799999998999851288899738888898--9------999986201-25--435
Q gi|254780725|r  237 PVFYA--ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS--W------TQEVLTLSD-KV--VIT  303 (427)
Q Consensus       237 l~~~~--~gL~lL~a~~~~~~~~~~~~~~l~~ll~~l~~~yd~VIiD~p~~~~~--~------~~~~L~~AD-~v--viV  303 (427)
T Consensus        80 MkqY~LGPNGgI~Ts----LNLF~tk~dqv~~~iek~~~~~~~~liDTPGQIE~FtWSAsGsIIte~lass~ptvv~Yvv  155 (366)
T KOG1532          80 MKQYQLGPNGGIVTS----LNLFATKFDQVIELIEKRAEEFDYVLIDTPGQIEAFTWSASGSIITETLASSFPTVVVYVV  155 (366)
T ss_pred             HHHHCCCCCCCHHHH----HHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCEEEEEECCCCCCHHHHHHHCCCEEEEEEE
T ss_conf             998388998640335----8999987899999999742204779974888068998427850158667613985999994


Q ss_pred             CCCCHHH-HHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCC--CHHHH---HHHHHHHC
Q ss_conf             7877688-999999999999819876753899956589875--20059---99999848
Q gi|254780725|r  304 TSLDLAG-LRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK--PEISI---SDFCAPLG  356 (427)
Q Consensus       304 ~~p~~~s-lr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~--~~i~~---~~~~~~lg  356 (427)
T Consensus       156 Dt~rs~~p~tFMSNMlYAcSilyktklp~ivvfNK~Dv~d~~fa~eWm~DfE~FqeAl~  214 (366)
T KOG1532         156 DTPRSTSPTTFMSNMLYACSILYKTKLPFIVVFNKTDVSDSEFALEWMTDFEAFQEALN  214 (366)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             47767884169988999999998626876999714344561889999999999999997