HHsearch alignment for GI: 254780725 and conserved domain: KOG3022

>KOG3022 consensus.
Probab=99.95  E-value=2.9e-26  Score=180.67  Aligned_cols=232  Identities=20%  Similarity=0.189  Sum_probs=176.2

Q ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHH
Q ss_conf             45675379997469887756899999999996269949999787989860334389987898886318456124337653
Q gi|254780725|r  157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL  236 (427)
Q Consensus       157 ~~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~  236 (427)
T Consensus        43 l~~vk~iI~VlSGKGGVGKSTvt~nla~~La~-~g~~vglLD~Dl~GPSiP~m~g~e~~~-~~---~~~~g~~Pv-----  112 (300)
T KOG3022          43 LSGVKHIILVLSGKGGVGKSTVTVNLALALAS-EGKKVGLLDADLCGPSIPRMMGLEGEV-VH---QSDNGWIPV-----  112 (300)
T ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHC-CCCCEEEEEECCCCCCCHHHCCCCCCE-EE---ECCCCCEEE-----
T ss_conf             13454589998678877616899999999861-797179975035587705340877744-55---048874144-----


Q ss_pred             HHCCCCCEEEEECCCCCC---CHHCC----CHHHHHHHHHHH-HHCCCEEEECCCCCCCHHHHHHHHHCCC---CCCCCC
Q ss_conf             202489806872487612---03207----999999989998-5128889973888889899999862012---543578
Q gi|254780725|r  237 PVFYAENLSILTAPAMLS---RTYDF----DEKMIVPVLDIL-EQIFPLVILDVPHVWNSWTQEVLTLSDK---VVITTS  305 (427)
Q Consensus       237 l~~~~~gL~lL~a~~~~~---~~~~~----~~~~l~~ll~~l-~~~yd~VIiD~p~~~~~~~~~~L~~AD~---vviV~~  305 (427)
T Consensus       113 --~~~~~l~~mS~gfLl~~~~~~vIwRGpkk~~~I~qflk~vdwg~lDyLviDtPPGtsDehls~~~~~~~~~gAviVTT  190 (300)
T KOG3022         113 --VVNKNLKLMSMGFLLKPRDDSVIWRGPKKNSMIKQFLKDVDWGELDYLVIDTPPGTSDEHLSLVQFLRESDGAVIVTT  190 (300)
T ss_pred             --EECCCEEEEEEEEECCCCCCCCEEECHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHEEECCCCCCCEEEEEC
T ss_conf             --443876788756432888766265454788999999716887776779995899987014310000445573499817


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC--CCCCH-------HHHHHHHHHHCCCEEEEECCCHHHHHHHHHC
Q ss_conf             77688999999999999819876753899956589--87520-------0599999984895379906879999998847
Q gi|254780725|r  306 LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT--PKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANS  376 (427)
Q Consensus       306 p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~--~~~~~-------i~~~~~~~~lg~~~~~~IP~D~~~~~~A~~~  376 (427)
T Consensus       191 PQ~vAl~Dv~K~i~fc~K~~I--~ilGvVENMs~f~Cp~C~~~~~iF~~gGg~~l~~~~glp~Lg~iPld~~i-~~~~d~  267 (300)
T KOG3022         191 PQEVALQDVRKEIDFCRKAGI--PILGVVENMSGFVCPKCGHSTNIFGSGGGERLAEELGLPLLGSLPLDPLI-AESSDS  267 (300)
T ss_pred             CHHHHHHHHHHHHHHHHHCCC--CEEEEEECCCCCCCCCCCCCCEECCCCCHHHHHHHCCCCEEEECCCCHHH-HHHCCC
T ss_conf             205566888865026664598--56888962555307887875533367628999987299757506788799-975348


Q ss_pred             CCCEEEECCCCHHHHHHHHHHHHHHCC
Q ss_conf             961898889998999999999998522
Q gi|254780725|r  377 GKMIHEVDPKSAIANLLVDFSRVLMGR  403 (427)
Q Consensus       377 G~pi~e~~p~s~~a~~~~~La~~i~gr  403 (427)
T Consensus       268 G~~~v~~~p~s~~~~af~~i~~~i~~~  294 (300)
T KOG3022         268 GVPFVEEYPDSPASEAFEDIAEKLVEQ  294 (300)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             983476079956999999999999986