HHsearch alignment for GI: 254780725 and conserved domain: PRK01077

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated.
Probab=99.11  E-value=8e-09  Score=73.41  Aligned_cols=178  Identities=13%  Similarity=0.131  Sum_probs=108.9

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCC
Q ss_conf             37999746988775689999999999626994999978798986033438998789888631845612433765320248
Q gi|254780725|r  162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA  241 (427)
Q Consensus       162 rvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~  241 (427)
T Consensus         4 p~lmI~gt~S~~GKT~vt~gL~r~l~~-rG~~VapFK~------------------------GPDyIdp~~~~~a~g~~~   58 (451)
T PRK01077          4 PALVIAAPASGSGKTTVTLGLMRALRR-RGLRVQPFKV------------------------GPDYIDPAFHAAATGRPS   58 (451)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHH-CCCCCCCCCC------------------------CCCCCCHHHHHHHHCCCC
T ss_conf             879998689999789999999999996-8794575357------------------------857629899999978975


Q ss_pred             CCEEEEECCCCCCCHHCCCHHHHHHHHHHHHHCCCEEEECCCCCC-----------CHHHHHHHHHCCCCCCCCCCCHHH
Q ss_conf             980687248761203207999999989998512888997388888-----------989999986201254357877688
Q gi|254780725|r  242 ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW-----------NSWTQEVLTLSDKVVITTSLDLAG  310 (427)
Q Consensus       242 ~gL~lL~a~~~~~~~~~~~~~~l~~ll~~l~~~yd~VIiD~p~~~-----------~~~~~~~L~~AD~vviV~~p~~~s  310 (427)
T Consensus        59 ~nL----------D~~l~~~~~v~~~~~~~~~~~D~~viEG~mGlyDG~~~~~~~gS~aeiA~~l~~P-ViLViD~~~~-  126 (451)
T PRK01077         59 RNL----------DSWMMGEDLVRALFARAAGGADIAVIEGVMGLFDGAGGDPDKGSTADIARLLGAP-VVLVVDASGM-  126 (451)
T ss_pred             CCC----------CHHHCCHHHHHHHHHHHCCCCCEEEEEECHHCCCCCCCCCCCCCHHHHHHHHCCC-EEEEECCCCH-
T ss_conf             358----------8344899999999997546688899850101134545677777789999870998-8999846620-


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCC
Q ss_conf             9999999999998198767538999565898752005999999848953799068799999988479
Q gi|254780725|r  311 LRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG  377 (427)
Q Consensus       311 lr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~~~~~lg~~~~~~IP~D~~~~~~A~~~G  377 (427)
T Consensus       127 ~~s~aa~v~G~~~~~~~~~I~GvIlNk~~g~~h~~ll~~~ie-~~gvpvlG~lP~~~~l~lpeRHLG  192 (451)
T PRK01077        127 AQSAAALVLGFARFDPDLNIAGVILNRVGSERHYQLLREALE-ELGLPVLGALPRDAALALPERHLG  192 (451)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHH-HCCCCEEEEECCCCCCCCCCCCCC
T ss_conf             899999999999759778774899624787668999999998-639957986157633456421257