HHsearch alignment for GI: 254780725 and conserved domain: PRK05537

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated.
Probab=97.83  E-value=0.00045  Score=44.21  Aligned_cols=145  Identities=18%  Similarity=0.186  Sum_probs=78.3

Q ss_pred             HHHHHHHCCCCEEECCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             99999976562643189998999997631023322234567537999746988775689999999999626994999978
Q gi|254780725|r  120 LYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL  199 (427)
Q Consensus       120 l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~~~~~~~~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDl  199 (427)
T Consensus       357 elr~~L~~G~~--IPeWft~PeV~~eLrr~----~PPr~~~G~tiwlTG-LsgsGKsTiA~al~~~L~~~~~~~v~lLDG  429 (568)
T PRK05537        357 ELRRRLREGLE--IPEWFSFPEVVAELRRT----YPPRHKQGFTVFFTG-LSGAGKSTIAKALMAKLMEMRGRPVTLLDG  429 (568)
T ss_pred             HHHHHHHCCCC--CCCCCCCHHHHHHHHHH----CCCCCCCCEEEEEEC-CCCCCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             99999867998--99553877899999985----687445864999845-788877699999999999718927999546


Q ss_pred             CCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCHHCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             79898603343899878988863184561243376532024898068724876120320799999998999851288899
Q gi|254780725|r  200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI  279 (427)
Q Consensus       200 Dl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~~gL~lL~a~~~~~~~~~~~~~~l~~ll~~l~~~yd~VI  279 (427)
T Consensus       430 D~~R~~l~~dLg----fs~~dR~enirR~~~--va~~~~~--~g~i~i~a~isP~~~---~R~~~r~~~~~~-~~f~ev~  497 (568)
T PRK05537        430 DVVRKHLSSELG----FSKEDRDLNILRIGF--VASEITK--NGGIAICAPIAPYRA---TRREVREMIEAF-GAFIEVY  497 (568)
T ss_pred             HHHHHHHCCCCC----CCHHHHHHHHHHHHH--HHHHHHH--CCCEEEEEECCCCHH---HHHHHHHHHCCC-CCEEEEE
T ss_conf             888742155789----898899999999999--9999985--897899950699979---999999985237-9779999


Q ss_pred             ECCC
Q ss_conf             7388
Q gi|254780725|r  280 LDVP  283 (427)
Q Consensus       280 iD~p  283 (427)
T Consensus       498 v~~p  501 (568)
T PRK05537        498 VATP  501 (568)
T ss_pred             ECCC
T ss_conf             7898