HHsearch alignment for GI: 254780725 and conserved domain: PRK05564

>PRK05564 DNA polymerase III subunit delta'; Validated.
Probab=91.95  E-value=0.89  Score=23.93  Aligned_cols=42  Identities=29%  Similarity=0.405  Sum_probs=30.1

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             999997631023322234567537999746988775689999999999
Q gi|254780725|r  140 ADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIA  187 (427)
Q Consensus       140 ~~l~~ai~~~~~~~~~~~~~~grvIav~g~KGGvGkTTiA~nLA~~LA  187 (427)
T Consensus        10 ~~i~~~L~~~i~-----~~rl~HAyLF~G-p~G~GK~~~A~~~A~~ll   51 (313)
T PRK05564         10 ENIKNRIDNSII-----KGKFSHASLIVG-EDGIGKSILAKEIANKIL   51 (313)
T ss_pred             HHHHHHHHHHHH-----CCCCCCEEEEEC-CCCCCHHHHHHHHHHHHH
T ss_conf             999999999998-----799875043279-998509999999999982