HHsearch alignment for GI: 254780725 and conserved domain: PRK05855

>PRK05855 short chain dehydrogenase; Validated.
Probab=91.98  E-value=0.22  Score=27.62  Aligned_cols=155  Identities=17%  Similarity=0.167  Sum_probs=75.2

Q ss_pred             CCCEEEEEECCCC----HHHHHHHHHCCCCEEEC--------CCCC-HHHHHHHHHHCCCC----C-----------CCC
Q ss_conf             9980899816871----89999999765626431--------8999-89999976310233----2-----------223
Q gi|254780725|r  105 SGTKVIVIGDTND----VSLYRALISNHVSEYLI--------EPLS-VADIINSISAIFTP----Q-----------EEG  156 (427)
Q Consensus       105 p~~~Vivig~~~d----~~l~r~l~r~Gv~dyl~--------~P~~-~~~l~~ai~~~~~~----~-----------~~~  156 (427)
T Consensus       232 ~~vPVq~iv~~~D~~v~p~l~~~~~~-w~~~l~rr~i~a~HW~p~s~P~~iA~~~~efv~~~~~~~~~~~~~~~~~~~~~  310 (582)
T PRK05855        232 THVPVQLIVPTGDPYVRPALYDDLAR-WVPRLWRREIKAGHWLPMSHPQVLAAAVAELIDAVEGGPPPRALLRARVGRPR  310 (582)
T ss_pred             CCCCEEEEEECCCCCCCHHHHCCHHH-CCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHCCCCCCCC
T ss_conf             88877997517887769777441444-17860898603785376679899999999999863578898667335458998


Q ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC-HHHC---CCCCCCCHHHHHCCCCCHHHHH
Q ss_conf             45675379997469887756899999999996269949999787989860-3343---8998789888631845612433
Q gi|254780725|r  157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA-NINF---DKDPINSISDAIYPVGRIDKAF  232 (427)
Q Consensus       157 ~~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~-~~~l---~~~~~~~l~d~l~~~~rlD~~~  232 (427)
T Consensus       311 ~rFsGKvAvVTGA~sGIGrA-----~A~~fA~-~GA~Vvl~Dr~~~~l~eta~ei~~~G~~a~~~~~DV-td~~av-~al  382 (582)
T PRK05855        311 GRFGGKLVVVTGAGSGIGRA-----TALAFAR-EGAEVVASDIDEAAAERTAALIRAAGAVAHAYRVDV-SDADAM-EAL  382 (582)
T ss_pred             CCCCCCEEEEECCCCHHHHH-----HHHHHHH-CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCC-CCHHHH-HHH
T ss_conf             87499589995875789999-----9999997-799999960799999999999995198489997558-999999-999


Q ss_pred             HHHHHHCCCCCEEEEECCCCC---CCHHCCCHHHHHHHHH
Q ss_conf             765320248980687248761---2032079999999899
Q gi|254780725|r  233 VSRLPVFYAENLSILTAPAML---SRTYDFDEKMIVPVLD  269 (427)
Q Consensus       233 l~~~l~~~~~gL~lL~a~~~~---~~~~~~~~~~l~~ll~  269 (427)
T Consensus       383 ~~~v~~~-~G~iDILVNNAGI~~~g~~~d~s~e~w~~v~d  421 (582)
T PRK05855        383 AEWVGAE-HGVPDIVVNNAGIGMAGGFLDTSAEEWDRVLD  421 (582)
T ss_pred             HHHHHHH-CCCCCEEEECCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             9999997-69999999898758997803299999999998