HHsearch alignment for GI: 254780725 and conserved domain: PRK06015

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.
Probab=90.19  E-value=1.3  Score=22.88  Aligned_cols=86  Identities=9%  Similarity=0.188  Sum_probs=61.8

Q ss_pred             EECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCCEEECCCCCH
Q ss_conf             30699899999986189984999980598767788999888532899808998168718999999976562643189998
Q gi|254780725|r   60 ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV  139 (427)
Q Consensus        60 v~~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~~~p~~~Vivig~~~d~~l~r~l~r~Gv~dyl~~P~~~  139 (427)
T Consensus        21 lr~~~~~~a~~~~~al~~gGi~~iEITlrt~~a~~~I~~l~~~~-p~~~-vGaGTVl~~e~~~~a~~aGA~-FiVSP~~~   97 (212)
T PRK06015         21 LLIDDVEHAVPLARALARGGLPAIEITLRTPAALDAIRAVAAEV-EEAI-VGAGTILNAKQFEDAAKAGSR-FIVSPGTT   97 (212)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHC-CCCE-EEEEECCCHHHHHHHHHCCCC-EEECCCCC
T ss_conf             97799999999999999879988999689951999999999869-9967-954211569999999984998-99858999


Q ss_pred             HHHHHHHHH
Q ss_conf             999997631
Q gi|254780725|r  140 ADIINSISA  148 (427)
Q Consensus       140 ~~l~~ai~~  148 (427)
T Consensus        98 ~~v~~~a~~  106 (212)
T PRK06015         98 QELLAAAND  106 (212)
T ss_pred             HHHHHHHHH
T ss_conf             999999998