HHsearch alignment for GI: 254780725 and conserved domain: PRK07263

>PRK07263 consensus.
Probab=97.02  E-value=0.0025  Score=39.65  Aligned_cols=46  Identities=13%  Similarity=0.161  Sum_probs=36.8

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
Q ss_conf             75379997469887756899999999996269949999787989860
Q gi|254780725|r  160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA  206 (427)
Q Consensus       160 ~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~  206 (427)
T Consensus       202 ~GdL-iviaaRPsmGKTa~alnia~~iA~~~~~~V~~fSlEMs~~ql  247 (453)
T PRK07263        202 PDQL-IILAARPAVGKTAFVLNIAQNVGTKQKKTVAIFSLEMGAESL  247 (453)
T ss_pred             CCCE-EEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHH
T ss_conf             7868-999727888478999999999998559828999246998999