HHsearch alignment for GI: 254780725 and conserved domain: PRK09354

>PRK09354 recA recombinase A; Provisional.
Probab=96.51  E-value=0.063  Score=31.03  Aligned_cols=45  Identities=16%  Similarity=0.143  Sum_probs=36.0

Q ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             45675379997469887756899999999996269949999787989
Q gi|254780725|r  157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY  203 (427)
Q Consensus       157 ~~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~  203 (427)
T Consensus        56 G~P~GRivEi~G-~esSGKTtlal~~iae-aQk~Gg~~a~iDaE~al  100 (350)
T PRK09354         56 GLPKGRIVEIYG-PESSGKTTLALHAIAE-AQKAGGTAAFIDAEHAL  100 (350)
T ss_pred             CCCCCCEEEEEC-CCCCCHHHHHHHHHHH-HHHCCCCEEEEEECCCC
T ss_conf             967870899988-9877799999999999-99759947999600027