HHsearch alignment for GI: 254780725 and conserved domain: PRK09361

>PRK09361 radB DNA repair and recombination protein RadB; Provisional.
Probab=97.63  E-value=0.0019  Score=40.31  Aligned_cols=40  Identities=20%  Similarity=0.285  Sum_probs=33.7

Q ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             675379997469887756899999999996269949999787
Q gi|254780725|r  159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD  200 (427)
Q Consensus       159 ~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlD  200 (427)
T Consensus        21 ~~G~itei~G-~pG~GKTtl~lq~a~~~~~-~g~~vlYidtE   60 (224)
T PRK09361         21 ERGTITQIYG-PPGSGKTNICIQLAVEAAR-QGKKVIYIDTE   60 (224)
T ss_pred             CCCEEEEEEC-CCCCCHHHHHHHHHHHHHH-CCCCEEEECCC
T ss_conf             8887999989-9998599999999999997-49909996787