HHsearch alignment for GI: 254780725 and conserved domain: PRK09958

>PRK09958 DNA-binding transcriptional activator EvgA; Provisional.
Probab=99.13  E-value=2.8e-09  Score=76.18  Aligned_cols=111  Identities=14%  Similarity=0.178  Sum_probs=90.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHCEEEEECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             89899999998864110020223730699899999986189984999980598767788999888532899808998168
Q gi|254780725|r   36 VTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDT  115 (427)
Q Consensus        36 ~~~~~~~~~~~~~~drr~~~~~~~v~~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~~~p~~~Vivig~~  115 (427)
T Consensus         8 Dh~lvr~gl~~ll~~~---~~~vv~~~~~~~~~l~~~~~~-~pDvvllDl~lp~~~G~~~~~~ir~~~-~~~~viv~s~~   82 (204)
T PRK09958          8 DHPLAIAAIRNLLIKN---DIEILAELTEGGSAVQRVETL-KPDIVIIDVDIPGVNGIQVLETLRKRQ-YSGIIIIVSAK   82 (204)
T ss_pred             CCHHHHHHHHHHHHHC---CCEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCHHHHHHHHHHC-CCEEEEEEECC
T ss_conf             9899999999999868---998999979999999998743-979999958999998416788898727-98059999724


Q ss_pred             CCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHCCC
Q ss_conf             718999999976562643189998999997631023
Q gi|254780725|r  116 NDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT  151 (427)
Q Consensus       116 ~d~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~  151 (427)
T Consensus        83 ~~~~~~~~a~~~Ga~g~l~K~~~~~~l~~aI~~v~~  118 (204)
T PRK09958         83 NDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKN  118 (204)
T ss_pred             CCCHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             652114433526863799789999999999999977