HHsearch alignment for GI: 254780725 and conserved domain: PRK10403

>PRK10403 transcriptional regulator NarP; Provisional.
Probab=99.16  E-value=1.5e-09  Score=77.86  Aligned_cols=120  Identities=16%  Similarity=0.118  Sum_probs=96.5

Q ss_pred             EEEEEEECCHHHHHHHHHHHHHHHHHHCEEEEECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCE
Q ss_conf             05999838989999999886411002022373069989999998618998499998059876778899988853289980
Q gi|254780725|r   29 ISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTK  108 (427)
Q Consensus        29 ~~~~~f~~~~~~~~~~~~~~~drr~~~~~~~v~~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~~~p~~~  108 (427)
T Consensus         7 irIlIvDD~~l~r~gl~~~L~~--~~~~~vv~~a~~~~~~~~~~~~~-~pDlvllD~~lp~~~G~~~~~~l~~~-~p~~~   82 (215)
T PRK10403          7 FQVLIVDDHPLMRRGVRQLLEL--DPGFEVVAEAGDGASAIDLANRL-DIDVILLDLNMKGMSGLDTLNALRRD-GVTAQ   82 (215)
T ss_pred             CEEEEECCCHHHHHHHHHHHHH--CCCEEEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCCCCHHHHHHHC-CCCCC
T ss_conf             5799983989999999999975--89928999989999999998644-99899980899899874123356541-88773


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHCCCC
Q ss_conf             89981687189999999765626431899989999976310233
Q gi|254780725|r  109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTP  152 (427)
Q Consensus       109 Vivig~~~d~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~~  152 (427)
T Consensus        83 iivlt~~~~~~~~~~al~~Ga~gyl~K~~~~~~l~~ai~~v~~G  126 (215)
T PRK10403         83 IIILTVSDASSDIFALIDAGADGYLLKDSDPEVLLEAIRAGAKG  126 (215)
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             68863243236789987468766884899999999999999849