HHsearch alignment for GI: 254780725 and conserved domain: PRK10643

>PRK10643 DNA-binding transcriptional regulator BasR; Provisional.
Probab=99.26  E-value=2.4e-10  Score=82.74  Aligned_cols=115  Identities=11%  Similarity=0.171  Sum_probs=94.6

Q ss_pred             EEEEECCHHHHHHHHHHHHHHHHHHCEEEEE-CCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEE
Q ss_conf             9998389899999998864110020223730-699899999986189984999980598767788999888532899808
Q gi|254780725|r   31 VHVFCVTDTLYSVVERSKIDPRMSQVNMRIT-RGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKV  109 (427)
Q Consensus        31 ~~~f~~~~~~~~~~~~~~~drr~~~~~~~v~-~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~~~p~~~V  109 (427)
T Consensus         3 ILlVEDd~~~~~~l~~~-----L~~~g~~V~~a~~~~ea~~~~~~~~-~DlvilDi~lp~~~G~~l~~~ir~~-~~~~pI   75 (222)
T PRK10643          3 ILIVEDDTLLLQGLILA-----AQTEGYACDGVSTAREAEQSLESGH-YSLVVLDLGLPDEDGLHFLARIRQK-KYTLPV   75 (222)
T ss_pred             EEEEECCHHHHHHHHHH-----HHHCCCEEEEECCHHHHHHHHHHCC-CCEEEEECCCCCCCCHHHHHHHHHC-CCCCCE
T ss_conf             99992889999999999-----9978999999899999999997489-9899996888998622689999834-899889


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHCCCC
Q ss_conf             9981687189999999765626431899989999976310233
Q gi|254780725|r  110 IVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTP  152 (427)
Q Consensus       110 ivig~~~d~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~~  152 (427)
T Consensus        76 I~lt~~~~~~~~~~~l~~GAddyi~KP~~~~eL~ari~~~lrr  118 (222)
T PRK10643         76 LILTARDTLEDRIAGLDVGADDYLVKPFALEELHARIRALLRR  118 (222)
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             9982103678899999759977643887689999999999703