HHsearch alignment for GI: 254780725 and conserved domain: PRK10751

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional.
Probab=94.40  E-value=0.15  Score=28.76  Aligned_cols=40  Identities=10%  Similarity=0.084  Sum_probs=35.2

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             379997469887756899999999996269949999787989
Q gi|254780725|r  162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY  203 (427)
Q Consensus       162 rvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~  203 (427)
T Consensus         3 Pii~ivG-~s~SGKTTLi~kli~~l~~-~G~rV~~IKH~~H~   42 (170)
T PRK10751          3 PLLAIAA-WSGTGKTTLLKKLIPALCA-RGIRPGLIKHTHHD   42 (170)
T ss_pred             CEEEEEE-CCCCCHHHHHHHHHHHHHH-CCCEEEEEECCCCC
T ss_conf             7799994-6999999999999999998-79849999457778