HHsearch alignment for GI: 254780725 and conserved domain: PRK10923

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional.
Probab=99.71  E-value=2.2e-15  Score=113.71  Aligned_cols=177  Identities=16%  Similarity=0.216  Sum_probs=131.4

Q ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHHHHCEEE-EECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             30599983898999999988641100202237-30699899999986189984999980598767788999888532899
Q gi|254780725|r   28 RISVHVFCVTDTLYSVVERSKIDPRMSQVNMR-ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSG  106 (427)
Q Consensus        28 ~~~~~~f~~~~~~~~~~~~~~~drr~~~~~~~-v~~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~~~p~  106 (427)
T Consensus         3 k~kILiVDDd~~~r~~l~~~L~~-----~g~~v~~a~~~~~al~~l~~~-~~dlvl~Di~mP~~~Gl~ll~~lr~~-~~~   75 (469)
T PRK10923          3 RGIVWVVDDDSSIRWVLERALAG-----AGLTCTTFENGNEVLEALASK-TPDVLLSDIRMPGMDGLALLKQIKQR-HPM   75 (469)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHH-----CCCEEEEECCHHHHHHHHHCC-CCCEEEECCCCCCCCHHHHHHHHHHC-CCC
T ss_conf             99799994989999999999987-----799899989999999998669-99999878999998999999999842-989


Q ss_pred             CEEEEEECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHCCCCC--------CCCCC--------------------
Q ss_conf             80899816871899999997656264318999899999763102332--------22345--------------------
Q gi|254780725|r  107 TKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQ--------EEGKG--------------------  158 (427)
Q Consensus       107 ~~Vivig~~~d~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~~~--------~~~~~--------------------  158 (427)
T Consensus        76 ~pvIviT~~~~~~~av~A~~~GA~dyL~KP~~~~~L~~~v~ral~~~~~~~~~~~~~~~~~~~~liG~S~~m~~v~~~i~  155 (469)
T PRK10923         76 LPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQQQPRNIQVNGPTTDIIGEAPAMQDVFRIIG  155 (469)
T ss_pred             CCEEEEECCCCHHHHHHHHHCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEECCHHHHHHHHHHH
T ss_conf             97899989999899999985570443008899999999999999999998654431210675565468999999999999


Q ss_pred             ---CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC--HHHCCCC
Q ss_conf             ---675379997469887756899999999996269949999787989860--3343899
Q gi|254780725|r  159 ---SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA--NINFDKD  213 (427)
Q Consensus       159 ---~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~--~~~l~~~  213 (427)
T Consensus       156 ~~a~~~~pVLI~G-E~GTGK~~~Ar~I-H~~S~r~~~pfi~vnC~~~~~~~~e~eLFG~~  213 (469)
T PRK10923        156 RLSRSSISVLING-ESGTGKELVAHAL-HRHSPRAKAPFIALNMAAIPKDLIESELFGHE  213 (469)
T ss_pred             HHHCCCCCEEEEC-CCCCCHHHHHHHH-HHCCCCCCCCCEEEECCCCCHHHHHHHHHCCC
T ss_conf             9858899789989-8982699999999-97488779995787678899778999970876