HHsearch alignment for GI: 254780725 and conserved domain: PRK11107

>PRK11107 hybrid sensory histidine kinase BarA; Provisional.
Probab=95.08  E-value=0.25  Score=27.33  Aligned_cols=117  Identities=14%  Similarity=0.145  Sum_probs=91.3

Q ss_pred             EEEEEEECCHHHHHHHHHHHHHHHHHHCEEE-EECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHH-CCCC
Q ss_conf             0599983898999999988641100202237-3069989999998618998499998059876778899988853-2899
Q gi|254780725|r   29 ISVHVFCVTDTLYSVVERSKIDPRMSQVNMR-ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEV-CDSG  106 (427)
Q Consensus        29 ~~~~~f~~~~~~~~~~~~~~~drr~~~~~~~-v~~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~-~~p~  106 (427)
T Consensus       669 lrVLvVEDN~iN~~vi~~lL~~-----lG~~v~~A~nG~eAle~~~~~~-fDLILMDiqMP~MDG~eATr~IR~~~~~~~  742 (920)
T PRK11107        669 LTVMAVDDNPANLKLIGALLEE-----QVEHVVLCDSGHQAVELAKQRP-FDLIFMDIQMPGMDGIRACELIRQLPHNQN  742 (920)
T ss_pred             CEEEEECCCHHHHHHHHHHHHH-----CCCEEEEECCHHHHHHHHHCCC-CCEEEECCCCCCCCHHHHHHHHHHCCCCCC
T ss_conf             7499984889999999999998-----4988999899999999974799-978998899999989999999981867898


Q ss_pred             CEEEEEECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHCCC
Q ss_conf             808998168718999999976562643189998999997631023
Q gi|254780725|r  107 TKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT  151 (427)
Q Consensus       107 ~~Vivig~~~d~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~  151 (427)
T Consensus       743 ~PIIAlTA~a~~~dre~cl~aGMddyLtKPI~~~~L~~~L~~~~~  787 (920)
T PRK11107        743 TPIIAVTAHAMAGERERLLGAGMDDYLAKPIDEAALKQVLLRWKP  787 (920)
T ss_pred             CEEEEEECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHCC
T ss_conf             959999799898999999977999387287999999999998678