HHsearch alignment for GI: 254780725 and conserved domain: PRK11147

>PRK11147 ABC transporter ATPase component; Reviewed.
Probab=93.44  E-value=0.36  Score=26.37  Aligned_cols=146  Identities=15%  Similarity=0.122  Sum_probs=73.1

Q ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHH-HCCCCCCCCHHHHHCCCCC-HHH----HH
Q ss_conf             67537999746988775689999999999626994999978798986033-4389987898886318456-124----33
Q gi|254780725|r  159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI-NFDKDPINSISDAIYPVGR-IDK----AF  232 (427)
Q Consensus       159 ~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~-~l~~~~~~~l~d~l~~~~r-lD~----~~  232 (427)
T Consensus       343 ~~Ge~ialvG-~NGsGKSTLlk~l~G~l~p~~G-~-i~~g~~~~i~y~~Q~~~~l~~~~tv~~~l~~~~~~~~~~~~~r~  419 (632)
T PRK11147        343 QRGDKIALIG-PNGCGKTTLLKLMLGQLQADSG-R-IHCGTKLEVAYFDQYRAELDPEKTVMDNLAEGKQEVMVNGKPRH  419 (632)
T ss_pred             CCCCEEEEEC-CCCCCHHHHHHHHHCCCCCCCC-E-EEECCCCEEEEEHHHHHHCCCCCCHHHHHHHCCHHCCCCHHHHH
T ss_conf             7887799988-9884277999986066689987-7-99899870775515476459768699999732321011558999


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCCHHCCCHHH--HHHHHHHHHHCCCEEEECCCCC-CCHHHHHH----HHHCCCCCCCCC
Q ss_conf             7653202489806872487612032079999--9998999851288899738888-89899999----862012543578
Q gi|254780725|r  233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKM--IVPVLDILEQIFPLVILDVPHV-WNSWTQEV----LTLSDKVVITTS  305 (427)
Q Consensus       233 l~~~l~~~~~gL~lL~a~~~~~~~~~~~~~~--l~~ll~~l~~~yd~VIiD~p~~-~~~~~~~~----L~~AD~vviV~~  305 (427)
T Consensus       420 ~~~~L~~-----f~f~~~~~~~~v~~LSGGEk~Rl~LA~~l~~~pnlLiLDEPTNhLDi~s~e~Le~aL~~y~Gtvl~VS  494 (632)
T PRK11147        420 VLGYLQD-----FLFHPKRAMTPVKALSGGERNRLLLARLFLKPSNLLILDEPTNDLDVETLELLEELLDSYQGTLLLVS  494 (632)
T ss_pred             HHHHHHH-----HCCCHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9999998-----57798896391553999999999999985779978999898765799999999999985898399997


Q ss_pred             CCHHHHH
Q ss_conf             7768899
Q gi|254780725|r  306 LDLAGLR  312 (427)
Q Consensus       306 p~~~slr  312 (427)
T Consensus       495 HDr~fl~  501 (632)
T PRK11147        495 HDRQFVD  501 (632)
T ss_pred             CCHHHHH
T ss_conf             9899998