HHsearch alignment for GI: 254780725 and conserved domain: PRK11697

>PRK11697 putative two-component response-regulatory protein YehT; Provisional.
Probab=98.44  E-value=7.9e-06  Score=55.01  Aligned_cols=112  Identities=11%  Similarity=0.213  Sum_probs=80.3

Q ss_pred             EEECCHHH-HHHHHHHHHHHHHHHCEEEEECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             98389899-99999886411002022373069989999998618998499998059876778899988853289980899
Q gi|254780725|r   33 VFCVTDTL-YSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIV  111 (427)
Q Consensus        33 ~f~~~~~~-~~~~~~~~~drr~~~~~~~v~~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l~~la~~~~p~~~Viv  111 (427)
T Consensus         5 ~I~DDe~~~~~~l~~~l~~--~~~i~~~~~~~~~~eal~~~~~~-~~DllfLDI~m~~~~G~ela~~l~~--~~~~~iIF   79 (239)
T PRK11697          5 LIVDDEPLAREELRELLQE--EGDIEIVGECSNAIEALGAIHRL-KPDVVFLDIQMPRISGLELVGMLDP--EHMPYIVF   79 (239)
T ss_pred             EEECCCHHHHHHHHHHHHH--CCCEEEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHHHHCC--CCCCEEEE
T ss_conf             9996999999999999975--87989999989999999999853-9999998399869599999998373--34986999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHCCC
Q ss_conf             8168718999999976562643189998999997631023
Q gi|254780725|r  112 IGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT  151 (427)
Q Consensus       112 ig~~~d~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~  151 (427)
T Consensus        80 vT~~~e~--a~~af~~~a~dYllKP~~~e~l~~~l~r~~~  117 (239)
T PRK11697         80 VTAFDEY--AIKAFEEHAFDYLLKPIDPARLAKTLARLRQ  117 (239)
T ss_pred             EECCHHH--HHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             9586899--9999730972665389999999999999999