HHsearch alignment for GI: 254780725 and conserved domain: PRK12726

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional.
Probab=98.25  E-value=3.4e-05  Score=51.13  Aligned_cols=163  Identities=13%  Similarity=0.132  Sum_probs=85.2

Q ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHH
Q ss_conf             56753799974698877568999999999962699499997879898603343899878988863184561243376532
Q gi|254780725|r  158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP  237 (427)
Q Consensus       158 ~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l  237 (427)
T Consensus       203 l~~g~VIaLVG-vnGvGKTTTiAKLA~~l~~-~gkkV~LVAaDTFRaAAiEQL------------k-------~~g~rl-  260 (407)
T PRK12726        203 LSNHRIISLIG-QTGVGKTTTLVKLGWQLLK-QNRTVGFITTDTFRSGAVEQF------------Q-------GYADKL-  260 (407)
T ss_pred             ECCCCEEEEEC-CCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHH------------H-------HHHHHH-
T ss_conf             03690899989-9989789999999999997-799179997066778899999------------9-------999997-


Q ss_pred             HCCCCCEEEEECCCCCCCHHCCCHHHHHHHHHH--HHHCCCEEEECCCCCCCH--HHHHHHH------HCCCCCCCCCCC
Q ss_conf             024898068724876120320799999998999--851288899738888898--9999986------201254357877
Q gi|254780725|r  238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDI--LEQIFPLVILDVPHVWNS--WTQEVLT------LSDKVVITTSLD  307 (427)
Q Consensus       238 ~~~~~gL~lL~a~~~~~~~~~~~~~~l~~ll~~--l~~~yd~VIiD~p~~~~~--~~~~~L~------~AD~vviV~~p~  307 (427)
T Consensus       261 -----gVpV~~~~-d--------pa~l~~av~~~a~~~~~DvVIIDTAGRl~~d~~Lm~EL~ki~~vi~P~~~lLV~dag  326 (407)
T PRK12726        261 -----DVELIVAT-S--------PAELEEAVQYMTYVNCVDHILIDTVGRNYLAEESVSEISAYTDVVHPDLTCFTFSSG  326 (407)
T ss_pred             -----CCEEEEEC-C--------HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             -----96499818-8--------899999999998628999899969998813499999999987332896699993675


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             6889999999999998198767538999565898752005999999848953799
Q gi|254780725|r  308 LAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI  362 (427)
Q Consensus       308 ~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~~~~~lg~~~~~~  362 (427)
T Consensus       327 ~~----~~~v~qa~~~~~~-v~ItGiILTKLDgtAKGG~-aLSi~~~~~lPI~fI  375 (407)
T PRK12726        327 MK----SADVMTILPKLAE-IPIDGFIITKMDETTRIGD-LYTVMQETNLPVLYM  375 (407)
T ss_pred             CC----HHHHHHHHHHHCC-CCCCEEEEEECCCCCCCCH-HHHHHHHHCCCEEEE
T ss_conf             66----9999999987047-9998799970147898539-999999988897999