HHsearch alignment for GI: 254780725 and conserved domain: PRK13185

>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional.
Probab=100.00  E-value=2.5e-31  Score=211.74  Aligned_cols=253  Identities=13%  Similarity=0.134  Sum_probs=192.3

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCC-CHHHHHHHHHHHC
Q ss_conf             537999746988775689999999999626994999978798986033438998789888631845-6124337653202
Q gi|254780725|r  161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVG-RIDKAFVSRLPVF  239 (427)
Q Consensus       161 grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~-rlD~~~l~~~l~~  239 (427)
T Consensus         2 ~~~iaiyG-KGGIGKSTttaNlsaALA~-~GkkV~~IgcDPk~DsT~~L~g-~~~~tild~l~~~~~~~~~~~~ed~~~~   78 (269)
T PRK13185          2 ALVLAVYG-KGGIGKSTTSSNLSAALAK-LGKKVLQIGCDPKHDSTFTLTG-KLVPTVIDILEEVDFHSEELRPEDFVFE   78 (269)
T ss_pred             CEEEEEEC-CCCCCHHHHHHHHHHHHHH-CCCEEEEECCCCCCCCHHHCCC-CCCCCHHHHHHHCCCCHHHCCHHHHHHC
T ss_conf             53999978-9954788899999999997-6993899818997323011259-9878789999743876021256677633


Q ss_pred             CCCCEEEEECCCC-CC--CHHCCCHHHHHHHHHHH--HHCCCEEEECCCCCCC-HHHHHHHHHCCCCCCCCCCCHHHHHH
Q ss_conf             4898068724876-12--03207999999989998--5128889973888889-89999986201254357877688999
Q gi|254780725|r  240 YAENLSILTAPAM-LS--RTYDFDEKMIVPVLDIL--EQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRN  313 (427)
Q Consensus       240 ~~~gL~lL~a~~~-~~--~~~~~~~~~l~~ll~~l--~~~yd~VIiD~p~~~~-~~~~~~L~~AD~vviV~~p~~~slr~  313 (427)
T Consensus        79 G~~gv~cvEaGGP~pG~GCaGrgi~~~~-~~L~~~~~~~~~D~Vl~DvlgdVvCGGFa~Pi~~Ad~~~IVts~e~~al~a  157 (269)
T PRK13185         79 GYNGVDCVEAGGPPAGTGCGGYVVGETV-KLLKEHHLLDDYDVILFDVLGDVVCGGFAAPLQYADYALIVTANDFDSIFA  157 (269)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHH-HHHHHCCCCCCCCEEEEECCCCCCCCCCCCCHHCCCEEEEEECCHHHHHHH
T ss_conf             7677056643899998776764318999-999872874337879995367433365557510088899992530878999


Q ss_pred             HHHHHHHHHHC--CCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCCHHHH
Q ss_conf             99999999981--9876753899956589875200599999984895379906879999998847961898889998999
Q gi|254780725|r  314 SKNLIDVLKKL--RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIAN  391 (427)
Q Consensus       314 a~~ll~~l~~~--~~~~~~~~iVlNr~~~~~~~~i~~~~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s~~a~  391 (427)
T Consensus       158 AnnI~~~i~~~a~~~~~rl~GiI~Nr~~~----~d~v~~fa~~~g~~vl~~IP~~~-~V~~se~~g~TviE~~p~~~~a~  232 (269)
T PRK13185        158 ANRIAAAIQAKAKNYKVRLAGVIANRSGG----TDQIDKFNERVGLRTLAHVPDLD-AIRRSRLKGKTLFEMEETDELEE  232 (269)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCCC----HHHHHHHHHHHCCCEEEECCCCH-HHHHHHHCCCEEEEECCCCHHHH
T ss_conf             99999999865301585323257616883----77999999986997699789978-89999874986788589981789


Q ss_pred             ---HHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             ---9999999985221223211105899998742
Q gi|254780725|r  392 ---LLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN  422 (427)
Q Consensus       392 ---~~~~La~~i~gr~~~~~~k~~~~~~l~~lf~  422 (427)
T Consensus       233 v~~~Yr~LA~~i~~~~~~~~P~pl~~~el~~l~~  266 (269)
T PRK13185        233 VQNEYLRLADQLLAGPEPLVPKPLKDREIFDLLS  266 (269)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             9999999999998289987888899899999974