HHsearch alignment for GI: 254780725 and conserved domain: PRK13435

>PRK13435 response regulator; Provisional.
Probab=99.20  E-value=6.8e-10  Score=79.99  Aligned_cols=113  Identities=12%  Similarity=0.161  Sum_probs=84.9

Q ss_pred             EEEEECCHHHHHHHHHHHHHHHHHHCEEE-E-ECCCHHHHHHHHHCCCCCCEEEEECCCC-CCCHHHHHHHHHHHCCCCC
Q ss_conf             99983898999999988641100202237-3-0699899999986189984999980598-7677889998885328998
Q gi|254780725|r   31 VHVFCVTDTLYSVVERSKIDPRMSQVNMR-I-TRGSIAEAVSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGT  107 (427)
Q Consensus        31 ~~~f~~~~~~~~~~~~~~~drr~~~~~~~-v-~~g~~~~A~~~~~~~~~P~~iivd~~~~-~~~~~~~l~~la~~~~p~~  107 (427)
T Consensus         4 ILIVEDe~~i~~~l~~~L-----~~~G~~vv~~A~~~~eAl~~~~~~-~PDlvllDi~LpdG~~G~e~~r~l~~--~~~i   75 (141)
T PRK13435          4 VLIVEDEALIALELEKLL-----EEAGHQVVGIASTSEQALALGRRA-QPDVALVDIRLADGPTGVEVARRLSI--DGGV   75 (141)
T ss_pred             EEEECCCHHHHHHHHHHH-----HHCCCEEEEEECCHHHHHHHHHCC-CCCEEEECCCCCCCCCHHHHHHHHHH--CCCC
T ss_conf             999899899999999999-----987997999759999999997659-99899978878999989999999987--5998


Q ss_pred             EEEEEECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHCCCCCC
Q ss_conf             08998168718999999976562643189998999997631023322
Q gi|254780725|r  108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQE  154 (427)
Q Consensus       108 ~Vivig~~~d~~l~r~l~r~Gv~dyl~~P~~~~~l~~ai~~~~~~~~  154 (427)
T Consensus        76 pvI~lTa~~d~---~~~~~aGA~dyl~KPf~~~eL~~ai~~~~~rr~  119 (141)
T PRK13435         76 EVIFMTANPER---VGHDFAGALGVIAKPYSLRQVARALSYVAARRV  119 (141)
T ss_pred             CEEEEECCHHH---HHHHHCCCCCEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             38999777998---601345998589899998999999999997156