HHsearch alignment for GI: 254780725 and conserved domain: TIGR00347

>TIGR00347 bioD dethiobiotin synthase; InterPro: IPR004472 The enzyme is involved in biotin biosynthesis and catalyses the reaction (CO2 + 7,8-diaminononanoate + ATP = dethiobiotin + phosphate + ADP). The enzyme binds ATP and requires magnesium as a co-factor. The Thr residue at position seven of the seed alignment is necessary for the binding of ATP.; GO: 0004141 dethiobiotin synthase activity, 0005524 ATP binding, 0009102 biotin biosynthetic process.
Probab=96.61  E-value=0.0073  Score=36.78  Aligned_cols=161  Identities=13%  Similarity=0.142  Sum_probs=86.5

Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC--HHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             97469887756899999999996269949999787989860--3343899878988863184561243376532024898
Q gi|254780725|r  166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA--NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN  243 (427)
Q Consensus       166 v~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~--~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~~g  243 (427)
T Consensus         2 vTGtDT~VGKT~~ss~La~~lk~-~G~~~g~~Kpv-~tG~~~~~~dL~~~D~~~L~~~~~~~~~~~~-----Pi~~~P--   72 (187)
T TIGR00347         2 VTGTDTGVGKTVVSSALAKKLKK-AGYSVGYYKPV-QTGIEETAEDLRNEDTELLQNISGTALDLDG-----PIEVNP--   72 (187)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHH-CCCCEEEECCH-HCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC-----CEEECC--
T ss_conf             10224586178998999999997-59852511200-0157667763105679999876544321389-----844266--


Q ss_pred             EEEEECCCCCC-----CHHCCCHHHHHHHHH----HHHHCCCEEEECCCCCC-CHHHHHHHHHCC-------------CC
Q ss_conf             06872487612-----032079999999899----98512888997388888-989999986201-------------25
Q gi|254780725|r  244 LSILTAPAMLS-----RTYDFDEKMIVPVLD----ILEQIFPLVILDVPHVW-NSWTQEVLTLSD-------------KV  300 (427)
Q Consensus       244 L~lL~a~~~~~-----~~~~~~~~~l~~ll~----~l~~~yd~VIiD~p~~~-~~~~~~~L~~AD-------------~v  300 (427)
T Consensus        73 -~~F~~PlsP~~A~~~Eg~~i~~~~~~~~~~naye~l~~~~d~~lVEGAGG~~vP~~r~~~t~~D~i~~~ietsGh~L~~  151 (187)
T TIGR00347        73 -YAFALPLSPHIAAKQEGRPIDLEELSKHLRNAYEELEEKYDFVLVEGAGGLCVPITREEYTVADLIKLLIETSGHQLPV  151 (187)
T ss_pred             -CCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             -3205688625888617783268889878878999999717917998336242666612457999999998505882027


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             435787768899999999999981987675389995
Q gi|254780725|r  301 VITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN  336 (427)
Q Consensus       301 viV~~p~~~slr~a~~ll~~l~~~~~~~~~~~iVlN  336 (427)
T Consensus       152 ilV~r~~LGtiNHt~Lt~~~~~~~Gl~shl~G~i~N  187 (187)
T TIGR00347       152 ILVVRVKLGTINHTLLTVEAARQTGLKSHLAGVILN  187 (187)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEEEC
T ss_conf             987468646067999999999977994443545619