HHsearch alignment for GI: 254780725 and conserved domain: TIGR00379

>TIGR00379 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR004484 This family describes cobyrinic acid a,c-diamide synthase, the cobB (cbiA in Salmonella) protein of cobalamin biosynthesis. It is responsible for the amidation of cobyrinic acid to cobyrinic acid a,c-diamide via the intermediate formation of cobyrinic acid c-monoamide or hydrogenobrynic acid. NH(2) groups are provided by glutamine and one molecule of ATP hydrogenolyzed for each amidation .; GO: 0042242 cobyrinic acid ac-diamide synthase activity, 0009236 cobalamin biosynthetic process.
Probab=97.88  E-value=0.0008  Score=42.67  Aligned_cols=198  Identities=18%  Similarity=0.152  Sum_probs=114.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             99974698877568999999999962699499997879898603343899878988863184561243376532024898
Q gi|254780725|r  164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN  243 (427)
Q Consensus       164 Iav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~~g  243 (427)
T Consensus         2 VviAGt~S~vGKT~I~~g~m~~L~~~-~~~V-------Q~fKV-----------------GPDYIDP~f-----------   45 (464)
T TIGR00379         2 VVIAGTSSKVGKTTISTGIMKALSRR-KLEV-------QPFKV-----------------GPDYIDPSF-----------   45 (464)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCC-CCCC-------CCEEE-----------------CCCCCCCCC-----------
T ss_conf             78830568754789999999998618-6324-------65442-----------------587437884-----------


Q ss_pred             EEEEE-C--CCCCCCHHCCCHHHHHHHHHHHHHCC--CEEEECCCC---------CCCH--HHHHHHHHCCC-CCCCCCC
Q ss_conf             06872-4--87612032079999999899985128--889973888---------8898--99999862012-5435787
Q gi|254780725|r  244 LSILT-A--PAMLSRTYDFDEKMIVPVLDILEQIF--PLVILDVPH---------VWNS--WTQEVLTLSDK-VVITTSL  306 (427)
Q Consensus       244 L~lL~-a--~~~~~~~~~~~~~~l~~ll~~l~~~y--d~VIiD~p~---------~~~~--~~~~~L~~AD~-vviV~~p  306 (427)
T Consensus        46 -H~~aTGr~sRNLD-sF~~~~~~i~~~F~~~~~~~Gs~~s~IEGv~GLYdg~Py~a~~d~gStA~vAk~L~~PvvLv~n~  123 (464)
T TIGR00379        46 -HTLATGRKSRNLD-SFFMSEAQIKELFIRHSKGAGSDVSIIEGVRGLYDGIPYSAISDKGSTASVAKALDAPVVLVVNA  123 (464)
T ss_pred             -CCCCCCCCCCCCC-HHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCEEEEEEC
T ss_conf             -5411478666768-53302899999999861347896579727413436768877687751889999865988999956


Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHH-CCCEEEEECCCHHHHHHHHHCC-CCEEEEC
Q ss_conf             7688999999999999819876753899956589875200599999984-8953799068799999988479-6189888
Q gi|254780725|r  307 DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPL-GITPSAIIPFDGAVFGMSANSG-KMIHEVD  384 (427)
Q Consensus       307 ~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~~~~~l-g~~~~~~IP~D~~~~~~A~~~G-~pi~e~~  384 (427)
T Consensus       124 ~-~L~~saaAiv~Gy~~fdp~V~l~GVILN~V~~~rH~~k~k~A~e~L~Pgi~vlG~~pR~~~l~~p~RHLGLVpa~E~-  201 (464)
T TIGR00379       124 K-RLSRSAAAIVLGYRSFDPDVKLKGVILNRVGSERHLEKLKTAVEKLAPGIEVLGVIPRKEDLKVPDRHLGLVPAVER-  201 (464)
T ss_pred             C-HHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCCCC-
T ss_conf             4-03357867764134308983178788731077446899999988636894588777367532147754653166135-


Q ss_pred             CCCHHHHHHHHHHHHHH
Q ss_conf             99989999999999985
Q gi|254780725|r  385 PKSAIANLLVDFSRVLM  401 (427)
Q Consensus       385 p~s~~a~~~~~La~~i~  401 (427)
T Consensus       202 l~~~~~~~~~~la~~~e  218 (464)
T TIGR00379       202 LDEIIQQILDWLAEVVE  218 (464)
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             31789999999999999