HHsearch alignment for GI: 254780725 and conserved domain: TIGR01007

>TIGR01007 eps_fam capsular exopolysaccharide family; InterPro: IPR005702 This family describes the capsular exopolysaccharide proteins in bacteria. The exopolysaccharide gene cluster consists of several genes which encode a number of proteins which regulate the exoploysaccharide biosynthesis (EPS). At least 13 genes EpsA to EpsM in streptococcus species seem to direct the EPS proteins and share high homology. ; GO: 0030234 enzyme regulator activity, 0045227 capsule polysaccharide biosynthetic process.
Probab=99.90  E-value=5.5e-23  Score=160.48  Aligned_cols=178  Identities=21%  Similarity=0.251  Sum_probs=151.6

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCC-CCCHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             7537999746988775689999999999626994999978798986033438998-789888631845612433765320
Q gi|254780725|r  160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP-INSISDAIYPVGRIDKAFVSRLPV  238 (427)
Q Consensus       160 ~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~-~~~l~d~l~~~~rlD~~~l~~~l~  238 (427)
T Consensus        18 e~K~l~itS~~~~eGKsT~S~NiA~~fAq-aGyKTLlIDgD~R~sv~~~~Fk~~n~~~GLtn~L~g~~dl~~~i~~T---   93 (207)
T TIGR01007        18 EIKVLLITSVKAGEGKSTTSANIAVSFAQ-AGYKTLLIDGDMRNSVMSGTFKSQNKIKGLTNFLSGNTDLSDAICET---   93 (207)
T ss_pred             CEEEEEEEECCCCCCCEEEEHHHHHHHHH-CCCEEEEEECCCCCCCEEEEECCCCCCCCCHHHHCCCCCHHHHHHCC---
T ss_conf             70589984110588862410788999985-68558887546586603678658887656333221454533342026---


Q ss_pred             CCCCCEEEEEC-CCCCCCHHCCCHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHH-HHHHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             24898068724-8761203207999999989998512888997388888989999-986201254357877688999999
Q gi|254780725|r  239 FYAENLSILTA-PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE-VLTLSDKVVITTSLDLAGLRNSKN  316 (427)
Q Consensus       239 ~~~~gL~lL~a-~~~~~~~~~~~~~~l~~ll~~l~~~yd~VIiD~p~~~~~~~~~-~L~~AD~vviV~~p~~~slr~a~~  316 (427)
T Consensus        94 ~isenL~vi~sG~vPPNPt~LL~s~~F~~l~e~~~~~fD~iiiDTPPig~V~DAai~a~~~d~~~LV~~A~~~~k~~v~K  173 (207)
T TIGR01007        94 NISENLDVITSGPVPPNPTELLQSSNFKTLIETLRKYFDYIIIDTPPIGTVIDAAIIARAVDASILVTDAGKIKKREVKK  173 (207)
T ss_pred             CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHCCEEEEEECCCCCHHHHHH
T ss_conf             54678727517887877547888899999999987168889995188666788999998729779887225326467899


Q ss_pred             HHHHHHHCCCCCCCCEEEEECCCCCCC
Q ss_conf             999999819876753899956589875
Q gi|254780725|r  317 LIDVLKKLRPADKPPYLVLNQVKTPKK  343 (427)
Q Consensus       317 ll~~l~~~~~~~~~~~iVlNr~~~~~~  343 (427)
T Consensus       174 AK~~LEq~G--~~~LGvvLNK~d~s~~  198 (207)
T TIGR01007       174 AKEQLEQAG--SKFLGVVLNKVDISVD  198 (207)
T ss_pred             HHHHHHHHC--CCEEEEEECCCCCCCC
T ss_conf             999998617--8411588888257655