HHsearch alignment for GI: 254780725 and conserved domain: TIGR01281

>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein; InterPro: IPR005971 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. The light-independent (dark) form of protochlorophyllide reductase plays a key role in the ability of gymnosperms, algae, and photosynthetic bacteria to form chlorophyll in the dark. Genetic and sequence analyses have indicated that dark protochlorophyllide reductase consists of three protein subunits that exhibit significant sequence similarity to the three subunits of nitrogenase, which catalyzes the reductive formation of ammonia from dinitrogen. Dark protochlorophyllide reductase activity was shown to be dependent on the presence of all three subunits, ATP, and the reductant dithionite. The BchL peptide (ChlL in chloroplast and cyanobacteria) is an ATP-binding iron-sulphur protein of the dark form protochlorophyllide reductase, an enzyme similar to nitrogenase . ; GO: 0005524 ATP binding, 0016730 oxidoreductase activity acting on iron-sulfur proteins as donors, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction.
Probab=99.91  E-value=3.5e-23  Score=161.69  Aligned_cols=256  Identities=14%  Similarity=0.174  Sum_probs=196.5

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCC-CHHHHHHHHHHHCC
Q ss_conf             37999746988775689999999999626994999978798986033438998789888631845-61243376532024
Q gi|254780725|r  162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVG-RIDKAFVSRLPVFY  240 (427)
Q Consensus       162 rvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~-rlD~~~l~~~l~~~  240 (427)
T Consensus         1 ~~lAvYG-KGGiGKSTTssNLSvA~A~-~GkkVlQIGCDPKh-DSTFTLtg~L~PTvidvL~~~~yH~E~v~~eD~iy~G   77 (275)
T TIGR01281         1 MILAVYG-KGGIGKSTTSSNLSVALAK-KGKKVLQIGCDPKH-DSTFTLTGKLIPTVIDVLDAVNYHYEDVEPEDVIYTG   77 (275)
T ss_pred             CEEEEEC-CCCCCCHHHHHHHHHHHHH-CCCEEEEECCCCCC-CCCCCCCCCCCCCEEEECCCCCCCEEECCCCCEEEEC
T ss_conf             9688863-8887700467899999984-69918985257888-8774544741674644225676303103337877834


Q ss_pred             CCCEEEEECCCCCCCHH---CCCHHHHHHHHHHH--HHCCCEEEEC-CCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             89806872487612032---07999999989998--5128889973-888889899999862012543578776889999
Q gi|254780725|r  241 AENLSILTAPAMLSRTY---DFDEKMIVPVLDIL--EQIFPLVILD-VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS  314 (427)
Q Consensus       241 ~~gL~lL~a~~~~~~~~---~~~~~~l~~ll~~l--~~~yd~VIiD-~p~~~~~~~~~~L~~AD~vviV~~p~~~slr~a  314 (427)
T Consensus        78 Y~GVd~vEaGGPPAGsGCGGYVVGeT-VKLLke~~~~~~yDVilFDVLGDVVCGGFAaPL~YAd~aLvva~NDFDalFAA  156 (275)
T TIGR01281        78 YGGVDCVEAGGPPAGSGCGGYVVGET-VKLLKELDVLDEYDVILFDVLGDVVCGGFAAPLQYADYALVVAANDFDALFAA  156 (275)
T ss_pred             CCCEEEEECCCCCCCCCCCCEEECCH-HHHHHHCCHHHHCCEEEEEECCCEEECCCCCHHHHHCCEEEEECCCCHHHHHH
T ss_conf             68568871473689888987471522-45566526334289799962575551754641123212566610772178999


Q ss_pred             HHHHHHHHHC--C-CCCCCCEEEEECCCCC-CCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC---
Q ss_conf             9999999981--9-8767538999565898-7520059999998489537990687999999884796189888999---
Q gi|254780725|r  315 KNLIDVLKKL--R-PADKPPYLVLNQVKTP-KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS---  387 (427)
Q Consensus       315 ~~ll~~l~~~--~-~~~~~~~iVlNr~~~~-~~~~i~~~~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s---  387 (427)
T Consensus       157 NRia~av~~K~~~Gy~vkLAGiIaNR~~~~yGGGtdlle~F~~~~~~~~l~~~P~~-d~IR~SRl~g~TlFEmee~~p~~  235 (275)
T TIGR01281       157 NRIAAAVREKAKSGYDVKLAGIIANRVDKEYGGGTDLLEKFAERVGTPVLGVVPRL-DEIRRSRLKGKTLFEMEESGPEL  235 (275)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHCCCCEEEECCCH-HHCCHHHHCCCCEEECCCCCCCH
T ss_conf             99999999984179707873266312113117871568999986288322007771-11020101586123015899658


Q ss_pred             -HHHHHHHHHHHHHHCC-CCCCCCCCCHHHHHHHHHH
Q ss_conf             -8999999999998522-1223211105899998742
Q gi|254780725|r  388 -AIANLLVDFSRVLMGR-VTVSKPQSAMYTKIKKIFN  422 (427)
Q Consensus       388 -~~a~~~~~La~~i~gr-~~~~~~k~~~~~~l~~lf~  422 (427)
T Consensus       236 ~~~~~~y~~~A~~LL~~Gp~~~vp~~~~dR~~F~ll~  272 (275)
T TIGR01281       236 EEVTAEYLKMAEYLLAKGPEGVVPKPLADREIFELLG  272 (275)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHC
T ss_conf             8999999999999986388973677410158998734