HHsearch alignment for GI: 254780725 and conserved domain: TIGR01846

>TIGR01846 type_I_sec_HlyB type I secretion system ATPase; InterPro: IPR010132 Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This entry contains one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane.
Probab=91.51  E-value=0.24  Score=27.48  Aligned_cols=107  Identities=16%  Similarity=0.159  Sum_probs=56.1

Q ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             67537999746988775689999999999626994999978798986033438998789888631845612433765320
Q gi|254780725|r  159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPV  238 (427)
Q Consensus       159 ~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~  238 (427)
T Consensus       489 ~~Ge~IGIvG-pSGSGKSTLTKL~QRLYtP~~G-qVLVDG~DLA~------------------------~DP~wLRRQ~g  542 (703)
T TIGR01846       489 KPGEVIGIVG-PSGSGKSTLTKLLQRLYTPEHG-QVLVDGVDLAI------------------------ADPAWLRRQVG  542 (703)
T ss_pred             CCCEEEEEEC-CCCCCHHHHHHHHHHHCCCCCC-EEEECCCCCCC------------------------CCCCHHHHCCE
T ss_conf             7865799872-7898678999998861488887-47770300010------------------------18520102230


Q ss_pred             CC-----------CCCEEEEECCCCCCCHHCC-CHHHHHHHHHHHHHCCCEEEECCCCCCCHHHH
Q ss_conf             24-----------8980687248761203207-99999998999851288899738888898999
Q gi|254780725|r  239 FY-----------AENLSILTAPAMLSRTYDF-DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQ  291 (427)
Q Consensus       239 ~~-----------~~gL~lL~a~~~~~~~~~~-~~~~l~~ll~~l~~~yd~VIiD~p~~~~~~~~  291 (427)
T Consensus       543 VVLQEn~LFsrSirdNI~l~~P~~~~E~Vi~AA~LAGA~dFI~~Lp~GY~T~vgE~G~~LSGGQR  607 (703)
T TIGR01846       543 VVLQENVLFSRSIRDNIALCNPGASVEHVIAAAKLAGAHDFISELPQGYNTEVGEKGANLSGGQR  607 (703)
T ss_pred             EEEECCHHHCCCHHHHHHHCCCCCCHHHHHHHHHHCCHHHHHHHCCCCCCCCCEEECCCCCCHHH
T ss_conf             23400021012278898517777698999999862185899973637677400124156673378