HHsearch alignment for GI: 254780725 and conserved domain: TIGR01968

>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. In Escherichia coli, the cell division site is determined by the cooperative activity of min operon products MinC, MinD, and MinE . MinD is a membrane-associated ATPase and is a septum site-determining factor through the activation and regulation of MinC and MinE. MinD is also known to undergo a rapid pole-to-pole oscillation movement in vivo as observed by fluorescent microscopy. In plants, chloroplast division requires the dimerisation of stromal MinD . The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model.; GO: 0016887 ATPase activity, 0000918 selection of site for barrier septum formation.
Probab=100.00  E-value=0  Score=317.58  Aligned_cols=254  Identities=20%  Similarity=0.346  Sum_probs=227.1

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCC--CCHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             5379997469887756899999999996269949999787989860334389987--89888631845612433765320
Q gi|254780725|r  161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI--NSISDAIYPVGRIDKAFVSRLPV  238 (427)
Q Consensus       161 grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~--~~l~d~l~~~~rlD~~~l~~~l~  238 (427)
T Consensus         1 ~~viViTSGKGGVGKTTtTANlG~aLA~-lG~kVvliD~DiGLRNLD~~lGLEnRivYt~vDVveG~C~l~qALikD---   76 (272)
T TIGR01968         1 ARVIVITSGKGGVGKTTTTANLGTALAR-LGKKVVLIDADIGLRNLDLLLGLENRIVYTLVDVVEGECRLQQALIKD---   76 (272)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHH-CCCEEEEEECCCCCHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCCC---
T ss_conf             9589998178897735898999999996-198289995475703457774231035453554324842110010012---


Q ss_pred             CCCCCEEEEECCCCCCCHHCCCHHHHHHHHHHHHHC--CCEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             248980687248761203207999999989998512--888997388888989999986201254357877688999999
Q gi|254780725|r  239 FYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI--FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN  316 (427)
Q Consensus       239 ~~~~gL~lL~a~~~~~~~~~~~~~~l~~ll~~l~~~--yd~VIiD~p~~~~~~~~~~L~~AD~vviV~~p~~~slr~a~~  316 (427)
T Consensus        77 Kr~~NL~LLpAsQ~rd-K~~~~~E~~~~lv~~Lk~~~~FDYviIDcPAGIE~GF~nAv~~Ad~AiVVttPEvsavRDADR  155 (272)
T TIGR01968        77 KRLENLYLLPASQTRD-KDAVTPEQMKKLVNELKEEEHFDYVIIDCPAGIESGFRNAVAPADEAIVVTTPEVSAVRDADR  155 (272)
T ss_pred             CCCHHHHHHHHHHCCC-CCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCCEEEEEECCCCCCHHHHHH
T ss_conf             6752356636530236-134697789999999854379307997378774356899875268358987787451002556


Q ss_pred             HHHHHHHCCCCCC-----CCEEEEECCCCC---CCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCC-C
Q ss_conf             9999998198767-----538999565898---752005999999848953799068799999988479618988899-9
Q gi|254780725|r  317 LIDVLKKLRPADK-----PPYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK-S  387 (427)
Q Consensus       317 ll~~l~~~~~~~~-----~~~iVlNr~~~~---~~~~i~~~~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~-s  387 (427)
T Consensus       156 vIGlLea~~~i~~~GEE~~~~LivNR~rP~mV~~G~Mlsi~Dv~~~L~i~LiGviPeD~~i-I~stN~GEP~vl-~~~L~  233 (272)
T TIGR01968       156 VIGLLEAKGNIEEKGEEVKIKLIVNRLRPEMVKKGDMLSIDDVLEILSIPLIGVIPEDEEI-IVSTNKGEPVVL-NKKLS  233 (272)
T ss_pred             HHHHHCCCCCCCCCCCEEEEEEEEECCCHHHHHCCCCCCHHHHHHHCCCCCEEEECCCCCE-EEEECCCEEEEE-CCCCC
T ss_conf             7524212455445776464347785156477416898278999986088616863299865-766456143544-60026


Q ss_pred             HHHHHHHHHHHHHHCCCC-----CCCCCCCHHHHHHHHH
Q ss_conf             899999999999852212-----2321110589999874
Q gi|254780725|r  388 AIANLLVDFSRVLMGRVT-----VSKPQSAMYTKIKKIF  421 (427)
Q Consensus       388 ~~a~~~~~La~~i~gr~~-----~~~~k~~~~~~l~~lf  421 (427)
T Consensus       234 ~~g~Af~~~ArRi~G~~vpf~~d~~~~~kG~~~~i~~~F  272 (272)
T TIGR01968       234 RAGKAFENIARRILGEEVPFEDDLEEQKKGFFARIKRFF  272 (272)
T ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHHHHCCHHHHHHHCC
T ss_conf             167889999875348864303334043022789987409