HHsearch alignment for GI: 254780725 and conserved domain: TIGR02016

>TIGR02016 BchX chlorophyllide reductase iron protein subunit X; InterPro: IPR010246 This entry represents the X subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase , . This enzyme is responsible for the reduction of the chlorin B-ring and is closely related to the protochlorophyllide reductase complex which reduces the D-ring. Both of these complexes in turn are homologous to nitrogenase. This subunit is homologous to the nitrogenase component II, or 'iron' protein.; GO: 0005524 ATP binding, 0016628 oxidoreductase activity acting on the CH-CH group of donors NAD or NADP as acceptor, 0051539 4 iron 4 sulfur cluster binding, 0015979 photosynthesis, 0030494 bacteriochlorophyll biosynthetic process.
Probab=99.82  E-value=9.2e-19  Score=134.54  Aligned_cols=229  Identities=19%  Similarity=0.220  Sum_probs=161.8

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCC---CCHHHH-----HH
Q ss_conf             3799974698877568999999999962699499997879898603343899878988863184---561243-----37
Q gi|254780725|r  162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV---GRIDKA-----FV  233 (427)
Q Consensus       162 rvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~---~rlD~~-----~l  233 (427)
T Consensus         1 r~iAiYG-KGG~GKSFtttNLs~~~A~-mgkRVL~lGCDPKhDst~~LFGGislPT~~ev~~ekk~agreEev~~~dv~F   78 (355)
T TIGR02016         1 RIIAIYG-KGGIGKSFTTTNLSAKLAL-MGKRVLQLGCDPKHDSTSALFGGISLPTVIEVFAEKKEAGREEEVKVSDVVF   78 (355)
T ss_pred             CEEEEEC-CCCCCHHHHHHHHHHHHHH-HCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEEEE
T ss_conf             9588974-8898667898999999997-4682354057897332221367866750889999986518732056611787


Q ss_pred             HHHHHCCCCCEEEEEC-CCCC----CCHHCCCHHHHHHHHHHHHHCCCEEEEC-CCCC-----CCHHHHHHHHHCCCCCC
Q ss_conf             6532024898068724-8761----2032079999999899985128889973-8888-----89899999862012543
Q gi|254780725|r  234 SRLPVFYAENLSILTA-PAML----SRTYDFDEKMIVPVLDILEQIFPLVILD-VPHV-----WNSWTQEVLTLSDKVVI  302 (427)
Q Consensus       234 ~~~l~~~~~gL~lL~a-~~~~----~~~~~~~~~~l~~ll~~l~~~yd~VIiD-~p~~-----~~~~~~~~L~~AD~vvi  302 (427)
T Consensus        79 k~~I~~~~~~vyg~ElGGPeVGRGCGGRGIi~GFd~LEKlG~~~W~~D~vlmDFLGDVVCGGFatPlaRs---laeeVi~  155 (355)
T TIGR02016        79 KRDIMNFAATVYGIELGGPEVGRGCGGRGIIFGFDLLEKLGLFEWELDFVLMDFLGDVVCGGFATPLARS---LAEEVIV  155 (355)
T ss_pred             ECCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHCCCCCCCHHHEEEECCCCEEECCCCCHHHHH---HHCCEEE
T ss_conf             2336889874578881787115546875310102566552744000200020005867756644312353---2024377


Q ss_pred             CCCCCHHHHHHHHHHHH---HHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEECCCHHHH--HHHHHCC
Q ss_conf             57877688999999999---999819876753899956589875200599999984895379906879999--9988479
Q gi|254780725|r  303 TTSLDLAGLRNSKNLID---VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVF--GMSANSG  377 (427)
Q Consensus       303 V~~p~~~slr~a~~ll~---~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~~~~~lg~~~~~~IP~D~~~~--~~A~~~G  377 (427)
T Consensus       156 ~~sNDrQSly~aNNic~A~~YFr~~GGr~~llGlvvNrDDG----sG~A~~fA~~~gipvLa~iP~d~~~Rdmddsfdfa  231 (355)
T TIGR02016       156 VTSNDRQSLYVANNICSAAEYFRKLGGRSKLLGLVVNRDDG----SGVAEAFAKEVGIPVLAKIPLDRKVRDMDDSFDFA  231 (355)
T ss_pred             EECCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCC----CCHHHHHHHHCCCCEEEECCCCCHHCCHHCCCHHE
T ss_conf             61374368888866988999998618860467889864688----71898989870993475267650010000000120


Q ss_pred             CCEEEECCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             6189888999899999999999852212
Q gi|254780725|r  378 KMIHEVDPKSAIANLLVDFSRVLMGRVT  405 (427)
Q Consensus       378 ~pi~e~~p~s~~a~~~~~La~~i~gr~~  405 (427)
T Consensus       232 ikl----P--evGeP~K~lA~~i~~~~~  253 (355)
T TIGR02016       232 IKL----P--EVGEPFKELADDILLALA  253 (355)
T ss_pred             EEC----C--CCCCHHHHHHHHHHHHHC
T ss_conf             206----7--667647899999997424