HHsearch alignment for GI: 254780725 and conserved domain: TIGR02632

>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase; InterPro: IPR013454 Rhamnose is a methyl-pentose sugar which is found as a constituent of pectin within the cell walls of dicotyledonous plants and has also been found in the mucilage of a number of legume plants . RhaD from Rhizobium leguminosarum bv. trifolii is encoded by a gene occurring in a rhamnose utilisation cluster, and is necessary for growth on this compound . This protein is predicted to be a bifunctional NAD-dependent aldolase/dehydrogenase..
Probab=93.72  E-value=0.061  Score=31.09  Aligned_cols=248  Identities=18%  Similarity=0.210  Sum_probs=123.8

Q ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHHHHCEEEEECCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHH-HHHHH-----
Q ss_conf             305999838989999999886411002022373069989999998618998499998059876778899-98885-----
Q gi|254780725|r   28 RISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSAL-EPLAE-----  101 (427)
Q Consensus        28 ~~~~~~f~~~~~~~~~~~~~~~drr~~~~~~~v~~g~~~~A~~~~~~~~~P~~iivd~~~~~~~~~~~l-~~la~-----  101 (427)
T Consensus       257 r~~i~~f~D~d~vL~Fvns~-e~~~La~LGts-----CPD---HflrTK-~~PL~iD~~P~-a~d~e~~~~~l~~~~~~Y  325 (709)
T TIGR02632       257 RRKIGTFDDSDAVLEFVNSK-EAPRLAALGTS-----CPD---HFLRTK-IRPLVIDWAPD-APDLEELVAKLKEGLEAY  325 (709)
T ss_pred             CCEEEEECCCHHHHHHHHHH-CCCCHHHCCCC-----CCC---CHHHCC-CCCEEEECCCC-CCCHHHHHHHHHHHHHHH
T ss_conf             20035323747888876202-13105650676-----653---012315-35525732688-765899999999999987


Q ss_pred             ---------H---------CCCCCEEEEE--------EC-----CCCHHHHHHHHH-----CCCCEEECCCCCHH-----
Q ss_conf             ---------3---------2899808998--------16-----871899999997-----65626431899989-----
Q gi|254780725|r  102 ---------V---------CDSGTKVIVI--------GD-----TNDVSLYRALIS-----NHVSEYLIEPLSVA-----  140 (427)
Q Consensus       102 ---------~---------~~p~~~Vivi--------g~-----~~d~~l~r~l~r-----~Gv~dyl~~P~~~~-----  140 (427)
T Consensus       326 r~dY~~YYe~~~~p~Sp~Mr~a~P~v~LvPGvGm~SfGkdk~~arva~efY~~AI~VMRGA~Av~~Y~~L~e~E~F~IEY  405 (709)
T TIGR02632       326 REDYARYYERHRRPDSPTMRDANPAVLLVPGVGMISFGKDKETARVAAEFYVNAINVMRGAEAVSEYAALPEQEAFDIEY  405 (709)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCCCCCH
T ss_conf             89999997503788648888868738970771345346666667888999999997415611121025875110334101


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHH
Q ss_conf             99997631023322234567537999746988775689999999999626994999978798986033438998789888
Q gi|254780725|r  141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD  220 (427)
Q Consensus       141 ~l~~ai~~~~~~~~~~~~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d  220 (427)
T Consensus       406 W~LE-eaKL~rmP~-ek~LA~~Va~VtGGasGIG~~-----~A~rL~~e-GAhvV~aD~d~~~a~~--------------  463 (709)
T TIGR02632       406 WALE-EAKLRRMPK-EKELARRVAFVTGGASGIGRE-----TARRLVDE-GAHVVLADLDAEAAEA--------------  463 (709)
T ss_pred             HHHH-HHHHHCCCC-CCCCCCEEEEEECCCCCHHHH-----HHHHHHHC-CCEEEEECCCHHHHHH--------------
T ss_conf             1679-998724765-967157068897388652689-----99999736-9779996236578999--------------


Q ss_pred             HHCCCCCHHHHHHHHHHHCCCCCEE-----EEEC-CCCCCCHHCCCHHHHHHHHHHHHHCC---CEEEECCCCCCCHHHH
Q ss_conf             6318456124337653202489806-----8724-87612032079999999899985128---8899738888898999
Q gi|254780725|r  221 AIYPVGRIDKAFVSRLPVFYAENLS-----ILTA-PAMLSRTYDFDEKMIVPVLDILEQIF---PLVILDVPHVWNSWTQ  291 (427)
Q Consensus       221 ~l~~~~rlD~~~l~~~l~~~~~gL~-----lL~a-~~~~~~~~~~~~~~l~~ll~~l~~~y---d~VIiD~p~~~~~~~~  291 (427)
T Consensus       464 -----------va~~~~~~fG~d~a~AGsdisaCGPaiGl~~DvT~e~~v~~~f~~v~~~yGGvD~vv~nAGi~~S~p~~  532 (709)
T TIGR02632       464 -----------VAAEIVDKFGADKAVAGSDISACGPAIGLKLDVTDEEAVKAAFAEVALAYGGVDIVVNNAGIAVSSPLE  532 (709)
T ss_