HHsearch alignment for GI: 254780725 and conserved domain: TIGR03594

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=92.31  E-value=0.54  Score=25.28  Aligned_cols=216  Identities=18%  Similarity=0.191  Sum_probs=112.2

Q ss_pred             HHHHHHCCCCCCEEEEECCCCC-CCHHHHHHHHHHHCCCCCEEEEEECCCC----HHHHHHHHHCCCCEEEC----CCCC
Q ss_conf             9999861899849999805987-6778899988853289980899816871----89999999765626431----8999
Q gi|254780725|r   68 AVSCFSDSSTPDLIIVQTKVDS-REVLSALEPLAEVCDSGTKVIVIGDTND----VSLYRALISNHVSEYLI----EPLS  138 (427)
Q Consensus        68 A~~~~~~~~~P~~iivd~~~~~-~~~~~~l~~la~~~~p~~~Vivig~~~d----~~l~r~l~r~Gv~dyl~----~P~~  138 (427)
T Consensus        72 ~~~ai~~a-DlIlfVvD~~~git~~D~~i~~~Lrk---~~k~vilviNK~D~~~~~~~~~ef~~LG~~~~i~iSA~h~~G  147 (429)
T TIGR03594        72 AEIAIEEA-DVILFVVDGREGLTPEDEEIAKWLRK---SGKPVILVANKIDGKKEDAVAAEFYSLGFGEPIPISAEHGRG  147 (429)
T ss_pred             HHHHHHHC-CEEEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             99999867-99999985776898679999999987---199789999834675314569999983689868874204679


Q ss_pred             HHHHHHHHHHCCCCCCCC--CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCC
Q ss_conf             899999763102332223--456753799974698877568999999999962699499997879898603343899878
Q gi|254780725|r  139 VADIINSISAIFTPQEEG--KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPIN  216 (427)
Q Consensus       139 ~~~l~~ai~~~~~~~~~~--~~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~  216 (427)
T Consensus       148 i~~L~~~i~~~l~~~~~~~~~~~~~iriaivG-rPNvGKSTl~N~l---l----~~~r~ivs~--~~GtTr---------  208 (429)
T TIGR03594       148 IGDLLDAILELLPEEEEEEEEEDGPIKIAIIG-RPNVGKSTLVNAL---L----GEERVIVSD--IAGTTR---------  208 (429)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEC-CCCCCHHHHHHHH---H----HHHHHHCCC--CCCCCC---------
T ss_conf             99999999965886655543455652699974-8876546777776---5----433321479--998631---------


Q ss_pred             CHHHHHCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCHHCCCHHHHHHHHHHHHHCCCEEEECCCCCC----------
Q ss_conf             9888631845612433765320248980687248761203207999999989998512888997388888----------
Q gi|254780725|r  217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW----------  286 (427)
Q Consensus       217 ~l~d~l~~~~rlD~~~l~~~l~~~~~gL~lL~a~~~~~~~~~~~~~~l~~ll~~l~~~yd~VIiD~p~~~----------  286 (427)
T Consensus       209 ---D~i~~~~-------------------------------~-------------~~~~~~~~iDTaGirkk~k~~~~~e  241 (429)
T TIGR03594       209 ---DSIDIPF-------------------------------E-------------RNGKKYLLIDTAGIRRKGKVTEGIE  241 (429)
T ss_pred             ---CCEEEEE-------------------------------E-------------ECCEEEEEEECCCCCCCCCCCHHHH
T ss_conf             ---0268799-------------------------------9-------------9990899998988763664230477


Q ss_pred             ---CHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCC
Q ss_conf             ---98999998620125435787768899999999999981987675389995658987520059999998489
Q gi|254780725|r  287 ---NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI  357 (427)
Q Consensus       287 ---~~~~~~~L~~AD~vviV~~p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~~~~~lg~  357 (427)
T Consensus       242 ~~s~~~t~~~i~~~dvvil~iD~~~~~~~qD~~i~~~i~~~~---k~~ii~~NK~Dli~~~-~~~~~~~~~i~~  311 (429)
T TIGR03594       242 KYSVLRTLKAIERADVVLLVLDATEGITEQDLRIAGLALEAG---KALIIVVNKWDLVKDE-KTREEFKKELRR  311 (429)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCC---CCEEEEEEHHHCCCCH-HHHHHHHHHHHH
T ss_conf             999999999987447799999766588488899999898739---9769999722303799-999999999998