HHsearch alignment for GI: 254780725 and conserved domain: cd00477

>cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate. FTHFS is a highly expressed key enzyme in both the Wood-Ljungdahl pathway of autotrophic CO2 fixation (acetogenesis) and the glycine synthase/reductase pathways of purinolysis. The key physiological role of this enzyme in acetogens is to catalyze the formylation of tetrahydrofolate, an initial step in the reduction of carbon dioxide and other one-carbon precursors to acetate. In purinolytic organisms, the enzymatic reaction is reversed, liberating formate from 10-formyltetrahydrofolate with concurrent production of ATP.
Probab=95.40  E-value=0.2  Score=27.93  Aligned_cols=100  Identities=14%  Similarity=0.220  Sum_probs=57.8

Q ss_pred             CCCHHHHH----HHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHH-HHHHHHHHCCCEEEEECCC---------HHHH
Q ss_conf             87768899----99999999998198767538999565898752005-9999998489537990687---------9999
Q gi|254780725|r  305 SLDLAGLR----NSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEIS-ISDFCAPLGITPSAIIPFD---------GAVF  370 (427)
Q Consensus       305 ~p~~~slr----~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~-~~~~~~~lg~~~~~~IP~D---------~~~~  370 (427)
T Consensus       332 ~en~~al~~G~~NL~~Hi~N~~~fg---vpvVVAIN~F~~DT~~Ei~~i~~~~~~~G~~~av~~~~a~GG~Ga~~LA~~V  408 (524)
T cd00477         332 EENLEALEKGFANLRKHIENIKKFG---VPVVVAINKFSTDTDAELALVRKLAEEAGAFVAVSEHWAEGGKGAVELAEAV  408 (524)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCC---CCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHCCCCHHHHHHHH
T ss_conf             6699999978766999998898628---9759995378998689999999999977996998062551551089999999


Q ss_pred             HHHHHCCCCEE-EECCCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99884796189-88899989999999999985221223
Q gi|254780725|r  371 GMSANSGKMIH-EVDPKSAIANLLVDFSRVLMGRVTVS  407 (427)
Q Consensus       371 ~~A~~~G~pi~-e~~p~s~~a~~~~~La~~i~gr~~~~  407 (427)
T Consensus       409 v~~~~~~~~f~~lY~~~~~l~eKI~~IA~~IYgA~~V~  446 (524)
T cd00477         409 IEACEQPSEFKFLYDLEDPLEDKIETIAKKIYGADGVE  446 (524)
T ss_pred             HHHHCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEE
T ss_conf             99860788866657999999999999999735988587