>cd00876 Ras Ras family. The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins. Ras proteins regulate cell growth, proliferation and differentiation. Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding. Many RasGEFs have been identified. These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of m

Probab=91.80 E-value=0.93 Score=23.83 Aligned_cols=110 Identities=18% Similarity=0.215 Sum_probs=67.6 Q ss_pred HCCCEEEECCCCCC--CHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHHCCC-CCCCCEEEEECCCCCCCCHHHH Q ss_conf 12888997388888--9899999862012543578-776889999999999998198-7675389995658987520059 Q gi|254780725|r 273 QIFPLVILDVPHVW--NSWTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVLKKLRP-ADKPPYLVLNQVKTPKKPEISI 348 (427) Q Consensus 273 ~~yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l~~~~~-~~~~~~iVlNr~~~~~~~~i~~ 348 (427) T Consensus 45 ~~~~l~i~Dt~g~~~~~~~~~~~~~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~piilvgnK~Dl~~~~~V~~ 124 (160) T cd00876 45 ETYTLDILDTAGQEEFSAMRDLYIRQGDGFILVYSITDRESFEEIKGYREQILRVKDDEDIPIVLVGNKCDLENERQVSK 124 (160) T ss_pred EEEEEEEEECCCCHHHHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHCCCCCH T ss_conf 99999999799962355788999764368999732898789999999999999972878862999997456223078999 Q ss_pred HHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHH Q ss_conf 999998489537990687999999884796189888999--8999999999998 Q gi|254780725|r 349 SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVL 400 (427) Q Consensus 349 ~~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i 400 (427) T Consensus 125 ~e~~~------------------~a~~~~~~y~e~Sak~g~nV~e~F~~i~~~i 160 (160) T cd00876 125 EEGKA------------------LAKEWGCPFIETSAKDNINIDEVFKLLVREI 160 (160) T ss_pred HHHHH------------------HHHHCCCEEEEECCCCCCCHHHHHHHHHHHC T ss_conf 99999------------------9998499799984798949899999999729

HHsearch alignment for GI: 254780725 and conserved domain: cd00876