HHsearch alignment for GI: 254780725 and conserved domain: cd00879

>cd00879 Sar1 Sar1 subfamily. Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER. The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER. Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12. Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification. Instead, Sar1 contains a unique nine-amino-acid N-terminal extension. This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif. The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=90.53  E-value=1.2  Score=23.06  Aligned_cols=85  Identities=18%  Similarity=0.228  Sum_probs=59.4

Q ss_pred             CCCEEEECCCCCCCH--HHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHH-HHCCCCCCCCEEEEECCCCCCCCHHHHH
Q ss_conf             288899738888898--99999862012543578-7768899999999999-9819876753899956589875200599
Q gi|254780725|r  274 IFPLVILDVPHVWNS--WTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVL-KKLRPADKPPYLVLNQVKTPKKPEISIS  349 (427)
Q Consensus       274 ~yd~VIiD~p~~~~~--~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l-~~~~~~~~~~~iVlNr~~~~~~~~i~~~  349 (427)
T Consensus        62 ~~~~~~wDvgG~~~~R~lW~~Y~~~~~~iIfVVDssD~~r~~eak~~L~~lL~~~~l~~~PlLIlaNK~Dl~~a--~~~~  139 (190)
T cd00879          62 NIKFKTFDLGGHEQARRLWKDYFPEVDGIVFLVDAADPERFQESKEELDSLLSDEELANVPFLILGNKIDLPGA--VSEE  139 (190)
T ss_pred             CEEEEEEECCCCCCCCCCHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCC--CCHH
T ss_conf             99999998999845554388884311379999977677899999999999985550069808999866677679--8999


Q ss_pred             HHHHHHCCCEE
Q ss_conf             99998489537
Q gi|254780725|r  350 DFCAPLGITPS  360 (427)
Q Consensus       350 ~~~~~lg~~~~  360 (427)
T Consensus       140 ei~~~L~L~~~  150 (190)
T cd00879         140 ELRQALGLYGT  150 (190)
T ss_pred             HHHHHCCCCCC
T ss_conf             99988398420