HHsearch alignment for GI: 254780725 and conserved domain: cd01125

>cd01125 repA Hexameric Replicative Helicase RepA. RepA is encoded by a plasmid, which is found in most Gram negative bacteria. RepA is a 5'-3' DNA helicase which can utilize ATP, GTP and CTP to a lesser extent.
Probab=97.11  E-value=0.0031  Score=39.04  Aligned_cols=111  Identities=17%  Similarity=0.187  Sum_probs=51.8

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCHHHCCCC-CCCCHHHHHCCCCCHHHHHHHHHHHCC
Q ss_conf             799974698877568999999999962699499997879-898603343899-878988863184561243376532024
Q gi|254780725|r  163 SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDL-PYGTANINFDKD-PINSISDAIYPVGRIDKAFVSRLPVFY  240 (427)
Q Consensus       163 vIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl-~~g~~~~~l~~~-~~~~l~d~l~~~~rlD~~~l~~~l~~~  240 (427)
T Consensus         2 ~v~~l~g~gG~GKS~lal~lAl~vA~--G~~~~g~~~~~~~~G~-Vly~~~Ed~~~~l~r------Rl~a~~~~~~~~~~   72 (239)
T cd01125           2 YVSALVAPGGTGKSSLLLVLALAMAL--GKNLFGGGLKVTEPGR-VVYLSAEDPREEIHR------RLEAILQHLEPDDA   72 (239)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHC--CCCCCCCCCCCCCCCE-EEEEECCCCHHHHHH------HHHHHHHHCCCCCC
T ss_conf             38999808998889999999999975--9965689854687761-999978899899999------99999986386655


Q ss_pred             CCCEEEEECCCCC----CCHHCCCHHHHHHHHHHHH-HCCCEEEECC
Q ss_conf             8980687248761----2032079999999899985-1288899738
Q gi|254780725|r  241 AENLSILTAPAML----SRTYDFDEKMIVPVLDILE-QIFPLVILDV  282 (427)
Q Consensus       241 ~~gL~lL~a~~~~----~~~~~~~~~~l~~ll~~l~-~~yd~VIiD~  282 (427)
T Consensus        73 ~~rl~~~~~~~~~l~~~~~~~~~~~~~~~~i~~~~~~~~~~LVViDp  119 (239)
T cd01125          73 GDRLFIDSGRIQPISIAREGRIIVVPEFERIIEQLLIRRIDLVVIDP  119 (239)
T ss_pred             CCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             54166415566644133577210148999999997458998999838