HHsearch alignment for GI: 254780725 and conserved domain: cd01394

>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=97.47  E-value=0.0034  Score=38.79  Aligned_cols=40  Identities=23%  Similarity=0.282  Sum_probs=33.5

Q ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             675379997469887756899999999996269949999787
Q gi|254780725|r  159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD  200 (427)
Q Consensus       159 ~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlD  200 (427)
T Consensus        17 ~~G~it~i~G-~pG~GKStl~lq~a~~~~~-~g~~v~YidtE   56 (218)
T cd01394          17 ERGTVTQVYG-PPGTGKTNIAIQLAVETAG-QGKKVAYIDTE   56 (218)
T ss_pred             CCCEEEEEEC-CCCCCHHHHHHHHHHHHHH-CCCEEEEEECC
T ss_conf             7887999989-9998499999999999863-69869999665