>cd01863 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex. In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos

Probab=91.11 E-value=1.1 Score=23.39 Aligned_cols=108 Identities=12% Similarity=0.169 Sum_probs=68.5 Q ss_pred CCCEEEECCCCCC--CHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHHCCCCC-CCCEEEEECCCCCCCCHHHHH Q ss_conf 2888997388888--9899999862012543578-77688999999999999819876-753899956589875200599 Q gi|254780725|r 274 IFPLVILDVPHVW--NSWTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVLKKLRPAD-KPPYLVLNQVKTPKKPEISIS 349 (427) Q Consensus 274 ~yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l~~~~~~~-~~~~iVlNr~~~~~~~~i~~~ 349 (427) T Consensus 48 ~~~l~iwDt~g~~~~~~~~~~~~~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~~~ilVgnK~D~~~~-~---- 122 (161) T cd01863 48 KVKLAIWDTAGQERFRTLTSSYYRGAQGVILVYDVTRRDTFTNLETWLNELETYSTNNDIVKMLVGNKIDKENR-E---- 122 (161) T ss_pred EEEEEEEECCCCCCCCCCHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCC-C---- T ss_conf 99999999999842353422441321534899767826569999999999998568888737887310440006-8---- Q ss_pred HHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHH Q ss_conf 99998489537990687999999884796189888999--8999999999998 Q gi|254780725|r 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVL 400 (427) Q Consensus 350 ~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i 400 (427) T Consensus 123 -------------v~~~-~~~~~a~~~~~~y~e~Sak~g~nV~~~F~~l~~~i 161 (161) T cd01863 123 -------------VTRE-EGLKFARKHNMLFIETSAKTRDGVQQAFEELVEKI 161 (161) T ss_pred -------------CCHH-HHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHC T ss_conf -------------9999-99999998699999971586815999999999709

HHsearch alignment for GI: 254780725 and conserved domain: cd01863