>cd01865 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D. All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression. Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules. Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot

Probab=95.43 E-value=0.19 Score=28.01 Aligned_cols=111 Identities=11% Similarity=0.102 Sum_probs=75.3 Q ss_pred CCCEEEECCCCC--CCHHHHHHHHHCCCCCCCCCC-CHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHH Q ss_conf 288899738888--898999998620125435787-76889999999999998198767538999565898752005999 Q gi|254780725|r 274 IFPLVILDVPHV--WNSWTQEVLTLSDKVVITTSL-DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISD 350 (427) Q Consensus 274 ~yd~VIiD~p~~--~~~~~~~~L~~AD~vviV~~p-~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~ 350 (427) T Consensus 49 ~i~l~iwDtaGqe~~~~l~~~y~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilvgNK~DL~~~r~v~~~~ 128 (165) T cd01865 49 RVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVVSSER 128 (165) T ss_pred EEEEEEEECCCCCCCCCCHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCCCCCHHH T ss_conf 99999996999834554415441135448998517887999999999999998689872599960242355518899999 Q ss_pred HHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHHHC Q ss_conf 9998489537990687999999884796189888999--899999999999852 Q gi|254780725|r 351 FCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVLMG 402 (427) Q Consensus 351 ~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i~g 402 (427) T Consensus 129 ~------------------~~~a~~~~~~~~E~SAk~~~nV~e~F~~l~~~i~~ 164 (165) T cd01865 129 G------------------RQLADQLGFEFFEASAKENINVKQVFERLVDIICD 164 (165) T ss_pred H------------------HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHC T ss_conf 9------------------99999869979997689890889999999999962

HHsearch alignment for GI: 254780725 and conserved domain: cd01865