>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhi

Probab=95.09 E-value=0.25 Score=27.34 Aligned_cols=111 Identities=14% Similarity=0.145 Sum_probs=73.2 Q ss_pred CCCEEEECCCCCC--CHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHH Q ss_conf 2888997388888--9899999862012543578-776889999999999998198767538999565898752005999 Q gi|254780725|r 274 IFPLVILDVPHVW--NSWTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISD 350 (427) Q Consensus 274 ~yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~ 350 (427) T Consensus 51 ~i~l~iwDt~G~e~~~~~~~~y~~~a~~~ilvfdit~~~Sf~~~~~w~~~i~~~~~~~~~~ilVgNK~Dl~~~r~v~~~e 130 (167) T cd01867 51 KIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITDEKSFENIRNWMRNIEEHASEDVERMLVGNKCDMEEKRVVSKEE 130 (167) T ss_pred EEEEEEEECCCCCCHHHHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHCCCCCHHH T ss_conf 99999998999700116679985650588995568987999999999999998669997057642124502307799999 Q ss_pred HHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHHHC Q ss_conf 9998489537990687999999884796189888999--899999999999852 Q gi|254780725|r 351 FCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVLMG 402 (427) Q Consensus 351 ~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i~g 402 (427) T Consensus 131 ~~------------------~~a~~~~~~~~e~SAktg~nI~e~F~~l~~~i~~ 166 (167) T cd01867 131 GE------------------ALADEYGIKFLETSAKANINVEEAFFTLAKDIKK 166 (167) T ss_pred HH------------------HHHHHHCCEEEEECCCCCCCHHHHHHHHHHHHHH T ss_conf 99------------------9999809969998225790789999999999970

HHsearch alignment for GI: 254780725 and conserved domain: cd01867