HHsearch alignment for GI: 254780725 and conserved domain: cd01868

>cd01868 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=94.97  E-value=0.27  Score=27.14  Aligned_cols=109  Identities=9%  Similarity=0.065  Sum_probs=70.4

Q ss_pred             CCCEEEECCCCCCC--HHHHHHHHHCCCCCCCCCC-CHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHH
Q ss_conf             28889973888889--8999998620125435787-76889999999999998198767538999565898752005999
Q gi|254780725|r  274 IFPLVILDVPHVWN--SWTQEVLTLSDKVVITTSL-DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISD  350 (427)
Q Consensus       274 ~yd~VIiD~p~~~~--~~~~~~L~~AD~vviV~~p-~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~  350 (427)
T Consensus        51 ~~~l~iwDtaG~e~~~~~~~~~~~~a~~~ilvydit~~~Sf~~i~~w~~~i~~~~~~~~~iilVgnK~DL~~~r~Vs~~e  130 (165)
T cd01868          51 TIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKKQTFENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTEE  130 (165)
T ss_pred             EEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHCCCCHHH
T ss_conf             99999998999721267899873320514898626988999999999999998555773598702347868857888999


Q ss_pred             HHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHH
Q ss_conf             9998489537990687999999884796189888999--8999999999998
Q gi|254780725|r  351 FCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVL  400 (427)
Q Consensus       351 ~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i  400 (427)
T Consensus       131 ~------------------~~~a~~~~~~~~E~SAk~g~nV~e~F~~l~~~i  164 (165)
T cd01868         131 A------------------KAFAEKNGLSFIETSALDGTNVEEAFKQLLTEI  164 (165)
T ss_pred             H------------------HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9------------------999998599799967888929899999999986