>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to t

Probab=93.91 E-value=0.47 Score=25.68 Aligned_cols=112 Identities=15% Similarity=0.192 Sum_probs=74.0 Q ss_pred HCCCEEEECCCCCC--CHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHH Q ss_conf 12888997388888--9899999862012543578-77688999999999999819876753899956589875200599 Q gi|254780725|r 273 QIFPLVILDVPHVW--NSWTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISIS 349 (427) Q Consensus 273 ~~yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~ 349 (427) T Consensus 49 ~~~~l~iwDtaG~e~~~~~~~~~~~~a~~~ilvfdit~~~Sf~~i~~w~~~i~~~~~~~~~~ilvgNK~DL~~~r~v~~~ 128 (166) T cd01869 49 KTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTDKRVVDYS 128 (166) T ss_pred EEEEEEEEECCCCCCCCCCHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCHH T ss_conf 99999999899982346267888563267799711799899999999999999867877744886132011314667999 Q ss_pred HHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHHHC Q ss_conf 99998489537990687999999884796189888999--899999999999852 Q gi|254780725|r 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVLMG 402 (427) Q Consensus 350 ~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i~g 402 (427) T Consensus 129 ~------------------~~~~a~~~~~~~~E~SAk~g~nI~e~F~~l~~~i~k 165 (166) T cd01869 129 E------------------AQEFADELGIPFLETSAKNATNVEQAFMTMAREIKK 165 (166) T ss_pred H------------------HHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHH T ss_conf 9------------------999999839969998768780689999999999971

HHsearch alignment for GI: 254780725 and conserved domain: cd01869