HHsearch alignment for GI: 254780725 and conserved domain: cd02034

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.
Probab=99.51  E-value=1.5e-13  Score=102.53  Aligned_cols=111  Identities=23%  Similarity=0.194  Sum_probs=77.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCC-
Q ss_conf             9997469887756899999999996269949999787989860334389987898886318456124337653202489-
Q gi|254780725|r  164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAE-  242 (427)
Q Consensus       164 Iav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~~-  242 (427)
T Consensus         2 ia~~G-KGGvGKtt~~~~la~~l~~-~g~~vl~iD~Dp~--dlpe--------------------------~~~~~~~~~   51 (116)
T cd02034           2 IAITG-KGGVGKTTIAALLARYLAE-KGKPVLAIDADPD--DLPE--------------------------RLSVEVGEI   51 (116)
T ss_pred             EEEEC-CCCCCHHHHHHHHHHHHHH-CCCEEEEEECCCC--CCHH--------------------------HHCEECCCC
T ss_conf             78988-9977499999999999997-8996999989897--1235--------------------------542331787


Q ss_pred             -CEEEEECCCCCCCH-HCCCHHHHHHHHHHH-HHCCCEEEECCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             -80687248761203-207999999989998-512888997388888989999986201254357
Q gi|254780725|r  243 -NLSILTAPAMLSRT-YDFDEKMIVPVLDIL-EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT  304 (427)
Q Consensus       243 -gL~lL~a~~~~~~~-~~~~~~~l~~ll~~l-~~~yd~VIiD~p~~~~~~~~~~L~~AD~vviV~  304 (427)
T Consensus        52 ~~l~~lg~~~~~g~GC~C~~n~ll~~~l~~l~~~~~~~VvvD~eAGiEHl~Rg~~~~vD~livVs  116 (116)
T cd02034          52 KLLLVMGMGRPGGEGCYCPENALLNALLRHLVLTRDEQVVVDTEAGLEHLGRGTAEGVDLLVVVN  116 (116)
T ss_pred             CEEEEEECCCCCCCCEECCHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHCCHHHCCCEEEEEC
T ss_conf             07999973435899408825789999999970679989999678548777300664399999969