HHsearch alignment for GI: 254780725 and conserved domain: cd02117

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase. Members of this family use energey from ATP hydrolysis and transfer electrons through a Fe4-S4 cluster to other subunit for reduction of substrate.
Probab=99.97  E-value=1.8e-29  Score=200.43  Aligned_cols=202  Identities=16%  Similarity=0.166  Sum_probs=148.4

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCC
Q ss_conf             37999746988775689999999999626994999978798986033438998789888631845612433765320248
Q gi|254780725|r  162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA  241 (427)
Q Consensus       162 rvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~  241 (427)
T Consensus         1 ~~iaiyG-KGGVGKTTts~NLaaaLA~-~G~rVl~iD~Dp~~~st~~L~g~~~~~~i~~~~~~~~~~~~~~~~~ii~~g~   78 (212)
T cd02117           1 RQIAIYG-KGGIGKSTTSQNLSAALAE-MGKKVLQVGCDPKADSTRLLLGGKAPTTILELAAEDGHVEDLELEDVIFEGF   78 (212)
T ss_pred             CEEEEEC-CCCCCHHHHHHHHHHHHHH-CCCEEEEEECCCCCCCCHHHCCCCCCCCHHHHHHHHCCCCCEEEEEEEEECC
T ss_conf             9599988-9835687789999999998-6996999903899873303119977871999987527866445667899668


Q ss_pred             CCEEEEECCCCCCCHH-----CCCHHHHHHHHHHHHHCCCEEEECCCCCCCH--HHH-HHHHHCCCCCCCCCCCHHHHHH
Q ss_conf             9806872487612032-----0799999998999851288899738888898--999-9986201254357877688999
Q gi|254780725|r  242 ENLSILTAPAMLSRTY-----DFDEKMIVPVLDILEQIFPLVILDVPHVWNS--WTQ-EVLTLSDKVVITTSLDLAGLRN  313 (427)
Q Consensus       242 ~gL~lL~a~~~~~~~~-----~~~~~~l~~ll~~l~~~yd~VIiD~p~~~~~--~~~-~~L~~AD~vviV~~p~~~slr~  313 (427)
T Consensus        79 ~gv~~veaggp~~g~~~ag~~i~~~~~ll~~~~~~~~~~D~IliD~lGdvv~~gf~~pi~~~~Ad~vlIvtt~E~~Al~~  158 (212)
T cd02117          79 GGVKCVESGGPEPGVGCAGRGVITAVNLLEKEGFAEDDLDVVLYDVLGDVVCGGFAMPIREGKADEIYIVTSGEFMALYA  158 (212)
T ss_pred             CCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEECCCCCCCCCCCCCEEEEECCCCHHHHHH
T ss_conf             87089988997767654541178899999974100257999999658854035633432116688899980693578898


Q ss_pred             HHHHHHHHHHC--CCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             99999999981--987675389995658987520059999998489537990687
Q gi|254780725|r  314 SKNLIDVLKKL--RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFD  366 (427)
Q Consensus       314 a~~ll~~l~~~--~~~~~~~~iVlNr~~~~~~~~i~~~~~~~~lg~~~~~~IP~D  366 (427)
T Consensus       159 a~~l~k~I~~~~~~~n~~l~GiI~N~~~~~~~-~~~i~~f~~~~g~~vl~~IP~d  212 (212)
T cd02117         159 ANNICKGIRKYAKSGGVRLGGLICNSRNTDRE-TELIDAFAERLGTQVIHFVPRD  212 (212)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEECCCCCCH-HHHHHHHHHHHCCEEEEECCCC
T ss_conf             89999999999736798148999846788864-9999999998399189974899