HHsearch alignment for GI: 254780725 and conserved domain: cd03109

>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms. The enzyme catalyzes formation of the ureido ring of dethiobiotin from (7R,8S)-7,8-diaminononanoic acid (DAPA) and carbon dioxide. The enzyme utilizes carbon dioxide instead of hydrogen carbonate as substrate and is dependent on ATP and divalent metal ions as cofactors.
Probab=97.67  E-value=0.00056  Score=43.64  Aligned_cols=126  Identities=13%  Similarity=0.092  Sum_probs=90.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             99974698877568999999999962699499997879898603343899878988863184561243376532024898
Q gi|254780725|r  164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN  243 (427)
Q Consensus       164 Iav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~~g  243 (427)
T Consensus         1 ~~~~GTdT~VGKT~vt~~l~~~l~~-~G~~v~~~K--Pv-----------------------------------------   36 (134)
T cd03109           1 IMGFGTGTDIGKTVATAILARALKE-KGYRVAPLK--PV-----------------------------------------   36 (134)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHH-CCCCEEEEC--HH-----------------------------------------
T ss_conf             9575278887689999999999997-799177875--66-----------------------------------------


Q ss_pred             EEEEECCCCCCCHHCCCHHHHHHHHHHHHHCCCEEEECCCCCC------CHHHHHHHHHC-CCCCCCCCCCHHHHHHHHH
Q ss_conf             0687248761203207999999989998512888997388888------98999998620-1254357877688999999
Q gi|254780725|r  244 LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW------NSWTQEVLTLS-DKVVITTSLDLAGLRNSKN  316 (427)
Q Consensus       244 L~lL~a~~~~~~~~~~~~~~l~~ll~~l~~~yd~VIiD~p~~~------~~~~~~~L~~A-D~vviV~~p~~~slr~a~~  316 (427)
T Consensus        37 -----------------------------~t~D~vlVEGaGG~~vPl~~~~~~~Dl~~~l~~pvIlV~~~~LG~INhtlL   87 (134)
T cd03109          37 -----------------------------QTYDFVLVEGAGGLCVPLKEDFTNADVAKELNLPAILVTSAGLGSINHAFL   87 (134)
T ss_pred             -----------------------------HCCCEEEEECCCCEEECCCCCCCHHHHHHHHCCCEEEEECCCCCHHHHHHH
T ss_conf             -----------------------------727989998897746003898629999997099989997788785899999


Q ss_pred             HHHHHHHCCCCCCCCEEEEECCCCCC-CCHHHHHHHHHHHCCCEEEEEC
Q ss_conf             99999981987675389995658987-5200599999984895379906
Q gi|254780725|r  317 LIDVLKKLRPADKPPYLVLNQVKTPK-KPEISISDFCAPLGITPSAIIP  364 (427)
Q Consensus       317 ll~~l~~~~~~~~~~~iVlNr~~~~~-~~~i~~~~~~~~lg~~~~~~IP  364 (427)
T Consensus        88 t~eal~~~gi~--v~G~i~N~~~~~~~~~~~N~~~I~~~t~vPvLG~vP  134 (134)
T cd03109          88 TIEAARIKGII--LNGVLGNVIVEKEGLATLNVETIERLTGIPVLGIVP  134 (134)
T ss_pred             HHHHHHHCCCC--EEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             99999987992--889999467997106787599999974999778288