HHsearch alignment for GI: 254780725 and conserved domain: cd03249

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=94.70  E-value=0.13  Score=29.15  Aligned_cols=41  Identities=24%  Similarity=0.406  Sum_probs=27.8

Q ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             6753799974698877568999999999962699499997879
Q gi|254780725|r  159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDL  201 (427)
Q Consensus       159 ~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl  201 (427)
T Consensus        27 ~~G~~iaIvG-~sGsGKSTLl~ll~gl~~p~-~G~I~idg~~i   67 (238)
T cd03249          27 PPGKTVALVG-SSGCGKSTVVSLLERFYDPT-SGEILLDGVDI   67 (238)
T ss_pred             CCCCEEEEEC-CCCCCHHHHHHHHHHCCCCC-CCEEEECCEEC
T ss_conf             6999999999-99998999999982386188-51899999992