HHsearch alignment for GI: 254780725 and conserved domain: cd03294

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.18  E-value=0.39  Score=26.16  Aligned_cols=42  Identities=21%  Similarity=0.248  Sum_probs=27.5

Q ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             56753799974698877568999999999962699499997879
Q gi|254780725|r  158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDL  201 (427)
Q Consensus       158 ~~~grvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl  201 (427)
T Consensus        47 i~~GE~~~ivG-~SGsGKSTLLr~i~GL~~p-~~G~I~~~G~~i   88 (269)
T cd03294          47 VREGEIFVIMG-LSGSGKSTLLRCINRLIEP-TSGKVLIDGQDI   88 (269)
T ss_pred             ECCCCEEEEEC-CCCCHHHHHHHHHHCCCCC-CCEEEEECCEEC
T ss_conf             88999999998-9984899999999759999-975999999999