>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II. Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells. In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine

Probab=93.70 E-value=0.51 Score=25.45 Aligned_cols=109 Identities=13% Similarity=0.156 Sum_probs=71.4 Q ss_pred CCCEEEECCCCCCC---HHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHHCCC-CCCCCEEEEECCCCCCCCHHHH Q ss_conf 28889973888889---899999862012543578-776889999999999998198-7675389995658987520059 Q gi|254780725|r 274 IFPLVILDVPHVWN---SWTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVLKKLRP-ADKPPYLVLNQVKTPKKPEISI 348 (427) Q Consensus 274 ~yd~VIiD~p~~~~---~~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l~~~~~-~~~~~~iVlNr~~~~~~~~i~~ 348 (427) T Consensus 50 ~v~l~iwDtaG~e~~~~s~~~~~~~~a~~~ilvydvt~~~Sf~~~~~w~~~i~~~~~~~~~p~vlVGNK~DL~~~r~Vs~ 129 (170) T cd04115 50 RIKVQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDVTNMASFHSLPSWIEECEQHSLPNEVPRILVGNKCDLREQIQVPT 129 (170) T ss_pred EEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHCCCCH T ss_conf 99999997788530567778998457735799950474767999999999999865888997999999821341178799 Q ss_pred HHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC-----HHHHHHHHHHHHH Q ss_conf 999998489537990687999999884796189888999-----8999999999998 Q gi|254780725|r 349 SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS-----AIANLLVDFSRVL 400 (427) Q Consensus 349 ~~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s-----~~a~~~~~La~~i 400 (427) T Consensus 130 ~------------------e~~~~a~~~~~~~~E~SAK~~~~~~nV~~~F~~la~~i 168 (170) T cd04115 130 D------------------LAQRFADAHSMPLFETSAKDPSENDHVEAIFMTLAHKL 168 (170) T ss_pred H------------------HHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHH T ss_conf 9------------------99999997799999988899851708899999999996

HHsearch alignment for GI: 254780725 and conserved domain: cd04115