>cd04117 Rab15 Rab15 subfamily. Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to

Probab=95.47 E-value=0.18 Score=28.28 Aligned_cols=110 Identities=9% Similarity=0.112 Sum_probs=74.0 Q ss_pred HCCCEEEECCCCCC--CHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHH Q ss_conf 12888997388888--9899999862012543578-77688999999999999819876753899956589875200599 Q gi|254780725|r 273 QIFPLVILDVPHVW--NSWTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISIS 349 (427) Q Consensus 273 ~~yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~ 349 (427) T Consensus 47 ~~i~l~iwDtaGqe~~~~~~~~y~r~a~~~ilvyDvt~~~Sf~~l~~w~~~i~~~~~~~~~~ilVgNK~Dl~~~r~v~-- 124 (161) T cd04117 47 IKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVG-- 124 (161) T ss_pred EEEEEEEEECCCCCCCCCCHHHHHHHHCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCCCC-- T ss_conf 999999997999602363558887641688996148988999999999999998789986499987327878627799-- Q ss_pred HHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHH Q ss_conf 99998489537990687999999884796189888999--8999999999998 Q gi|254780725|r 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVL 400 (427) Q Consensus 350 ~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i 400 (427) T Consensus 125 ---------------~~-~~~~~a~~~~~~~~etSAk~~~nV~e~F~~l~~~i 161 (161) T cd04117 125 ---------------DE-QGNKLAKEYGMDFFETSACTNSNIKESFTRLTELV 161 (161) T ss_pred ---------------HH-HHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHC T ss_conf ---------------99-99999998699799967789829899999999649

HHsearch alignment for GI: 254780725 and conserved domain: cd04117