HHsearch alignment for GI: 254780725 and conserved domain: cd04124

>cd04124 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share 98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=92.61  E-value=0.74  Score=24.42  Aligned_cols=107  Identities=11%  Similarity=0.210  Sum_probs=75.6

Q ss_pred             HCCCEEEECCCCC--CCHHHHHHHHHCCCCCCCCCC-CHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHH
Q ss_conf             1288899738888--898999998620125435787-7688999999999999819876753899956589875200599
Q gi|254780725|r  273 QIFPLVILDVPHV--WNSWTQEVLTLSDKVVITTSL-DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISIS  349 (427)
Q Consensus       273 ~~yd~VIiD~p~~--~~~~~~~~L~~AD~vviV~~p-~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~  349 (427)
T Consensus        47 ~~~~l~iwDtaG~e~f~~~~~~y~~~a~~~ilvfDit~~~Sf~~~~~w~~~i~~~~~-~~p~ilVgNK~DL~~~--~~--  121 (161)
T cd04124          47 KTILVDFWDTAGQERFQTMHASYYHKAHACILVFDVTRKITYKNLSKWYEELREYRP-EIPCIVVANKIDLDPS--VT--  121 (161)
T ss_pred             EEEEEEEEECCCCCCCCHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCCH--HH--
T ss_conf             999999997999843432469973568767999968977889999999999998686-9989999997117742--58--


Q ss_pred             HHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHHH
Q ss_conf             99998489537990687999999884796189888999--89999999999985
Q gi|254780725|r  350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVLM  401 (427)
Q Consensus       350 ~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i~  401 (427)
T Consensus       122 ---------------~--~~~~~a~~~~~~f~etSAk~g~nV~e~F~~l~~~~i  158 (161)
T cd04124         122 ---------------Q--KKFNFAEKHNLPLYYVSAADGTNVVKLFQDAIKLAV  158 (161)
T ss_pred             ---------------H--HHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             ---------------9--999999986991999907838097999999999998