HHsearch alignment for GI: 254780725 and conserved domain: cd04127

>cd04127 Rab27A Rab27a subfamily. The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b. Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions. Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder. When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated
Probab=93.50  E-value=0.55  Score=25.23  Aligned_cols=111  Identities=14%  Similarity=0.139  Sum_probs=72.6

Q ss_pred             CCEEEECCCCCC--CHHHHHHHHHCCCCCCCCCC-CHHHHHHHHHHHHHHHHCCCCC-CCCEEEEECCCCCCCCHHHHHH
Q ss_conf             888997388888--98999998620125435787-7688999999999999819876-7538999565898752005999
Q gi|254780725|r  275 FPLVILDVPHVW--NSWTQEVLTLSDKVVITTSL-DLAGLRNSKNLIDVLKKLRPAD-KPPYLVLNQVKTPKKPEISISD  350 (427)
Q Consensus       275 yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~p-~~~slr~a~~ll~~l~~~~~~~-~~~~iVlNr~~~~~~~~i~~~~  350 (427)
T Consensus        63 v~l~iwDtaGqe~~~~l~~~~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~~iilVGNK~DL~~~r~V~~~e  142 (180)
T cd04127          63 IHLQLWDTAGQERFRSLTTAFFRDAMGFLLIFDLTNEQSFLNVRNWMSQLQTHAYCENPDIVLCGNKADLEDQRQVSEEQ  142 (180)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHCCCCCHHH
T ss_conf             99999989886304788899987543658999689889999899999999985466898578750323667508889999


Q ss_pred             HHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHHHCC
Q ss_conf             9998489537990687999999884796189888999--8999999999998522
Q gi|254780725|r  351 FCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVLMGR  403 (427)
Q Consensus       351 ~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i~gr  403 (427)
T Consensus       143 ------------------~~~~a~~~~~~~~E~SAk~g~nV~e~F~~l~~~i~~~  179 (180)
T cd04127         143 ------------------AKALADKYGIPYFETSAATGTNVEKAVERLLDL