>cd04160 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif. Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes. It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network. Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D. Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.

Probab=90.65 E-value=0.92 Score=23.85 Aligned_cols=81 Identities=12% Similarity=0.143 Sum_probs=52.9 Q ss_pred CCCEEEECCCCCC--CHHHHHHHHHCCCCCCCCCC-CHHHHHHHHHHHHHH-HHCCCCCCCCEEEEECCCCCCCCHHHHH Q ss_conf 2888997388888--98999998620125435787-768899999999999-9819876753899956589875200599 Q gi|254780725|r 274 IFPLVILDVPHVW--NSWTQEVLTLSDKVVITTSL-DLAGLRNSKNLIDVL-KKLRPADKPPYLVLNQVKTPKKPEISIS 349 (427) Q Consensus 274 ~yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~p-~~~slr~a~~ll~~l-~~~~~~~~~~~iVlNr~~~~~~~~i~~~ 349 (427) T Consensus 49 ~~~l~iwD~~Gqe~~~~l~~~y~~~a~~ii~VvD~sd~~~~~~~~~~l~~~~~~~~~~~~pili~~NK~Dl~~~--~~~~ 126 (167) T cd04160 49 NARLKFWDLGGQESLRSLWDKYYAECHAIIYVIDSTDRERFEESKSALEKVLRNEALEGVPLLILANKQDLPDA--LSVE 126 (167) T ss_pred CEEEEEEECCCCHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCC--CCHH T ss_conf 99999996898788878998742898789999866867889999999999751102489629999706676657--7899 Q ss_pred HHHHHHC Q ss_conf 9999848 Q gi|254780725|r 350 DFCAPLG 356 (427) Q Consensus 350 ~~~~~lg 356 (427) T Consensus 127 ei~~~~~ 133 (167) T cd04160 127 EIKEVFQ 133 (167) T ss_pred HHHHHHH T ss_conf 9999999

HHsearch alignment for GI: 254780725 and conserved domain: cd04160